Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZPBP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309317100UL
Description
ZPBP2 Polyclonal specifically detects ZPBP2 in Human samples. It is validated for Western Blot.Specifications
ZPBP2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
CAAX prenyl protease 1 homolog, EC 3.4.24.84, FACE1FLJ14968, FACE-1zinc metalloproteinase (STE24 homolog, yeast), Farnesylated proteins-converting enzyme 1, farnesylated-proteins converting enzyme 1, HGPS, Hutchinson-Gilford progeria syndrome, MADB, Prenyl protein-specific endoprotease 1, PRO1, Ste24p, STE24zinc metallopeptidase (STE24 homolog, yeast), zinc metallopeptidase (STE24 homolog, S. cerevisiae), Zinc metalloproteinase Ste24 homolog | |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZPBP2 (NP_955353). Peptide sequence MMRTCVLLSAVLWCLTGVQCPRFTLFNKKGFIYGKTGQPDKIYVELHQNS | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
124626 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction