Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ZSCAN21/ZFP38 Antibody, Novus Biologicals™

ZSCAN21/ZFP38 Antibody, Novus Biologicals™
SDP

Catalog No. NBP184182 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP184182 0.1 mL
NB432785 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP184182 Supplier Novus Biologicals Supplier No. NBP184182
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 1 publication

ZSCAN21/ZFP38 Polyclonal specifically detects ZSCAN21/ZFP38 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen ZSCAN21/ZFP38
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias DKFZp434L134, KOX25, NY-REN-21, Renal carcinoma antigen NY-REN-21, Zfp-38, ZFP38, zinc finger and SCAN domain containing 21, zinc finger and SCAN domain-containing protein 21, zinc finger protein 38, zinc finger protein 38 (KOX 25), Zinc finger protein 38 homolog, zinc finger protein NY-REN-21 antigen, Zipro1, ZNF38DKFZp686H10254
Gene Symbols ZSCAN21
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PLQEAGSKKGRESVPTKPTPGERRYICAECGKAFSNSSNLTKHRRTHTGEKPYVCTKCGKAFSHSSNLTLHYRTHLVDRPYDCKCGKAFGQSSDLLKHQRMHTEEAPYQCKDCGKAFSGKGSLIRHYRIHTGEKPYQCNECGKSFSQHA
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7589
Test Specificity Specificity of human ZSCAN21/ZFP38 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.