Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZSCAN5C Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191389

 View more versions of this product

Catalog No. NBP191389


Add to cart

Description

Description

ZSCAN5C Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

ZSCAN5C
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
ZNF495C, ZSCAN5C zinc finger and SCAN domain containing 5C
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
649137
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
Affinity Purified
LOC649137
Synthetic peptide directed towards the C terminal of human LOC649137. Peptide sequence LKCHKRSHTGEKPFECKDCKKVFTYKANLKEHQRIHSGEKPHKCSKCPRA.
41 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Human: 100%; Bovine: 92%; Mouse: 92%; Xenopus: 91%; Crab-eating macaque: 91%; Transparent sea squirt: 91%; Green puffer: 91%; Sumatran orangutan: 91%; Golden hamster: 91%; African malaria mosquito: 91%; Canine: 91%; Chicken: 91%; Zebrafish: 91%; Southern house mosquito: 91%; Western clawed frog: 91%; Rat: 91%; Florida lancelet: 91%; Blood fluke: 91%; European domestic ferret: 91%; Atlantic salmon: 85%; Japanese pufferfish: 85%; Starlet sea anemone: 84%; Chimpanzee: 84%; Pig-tailed macaque: 84%; Rhesus macaque: 84%; Lowland gorilla: 84%; Pygmy chimpanzee: 84%; Western Gorilla: 78%; Red-chested mustached tamarin: 78%; Black-handed spider monkey: 78%; Bornean orangutan: 78%; Yellowfever mosquito: 78%.
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit