Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ZSCAN5C Antibody, Novus Biologicals™

ZSCAN5C Antibody, Novus Biologicals™
SDP

Catalog No. NBP191389 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP191389 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP191389 Supplier Novus Biologicals Supplier No. NBP191389
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ZSCAN5C Polyclonal specifically detects ZSCAN5C in Human samples. It is validated for Western Blot.

Specifications

Antigen ZSCAN5C
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias ZNF495C, ZSCAN5C zinc finger and SCAN domain containing 5C
Gene Symbols ZSCAN5C
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human LOC649137. Peptide sequence LKCHKRSHTGEKPFECKDCKKVFTYKANLKEHQRIHSGEKPHKCSKCPRA.
Molecular Weight of Antigen 41 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 649137
Test Specificity Expected identity based on immunogen sequence: Human: 100%; Bovine: 92%; Mouse: 92%; Xenopus: 91%; Crab-eating macaque: 91%; Transparent sea squirt: 91%; Green puffer: 91%; Sumatran orangutan: 91%; Golden hamster: 91%; African malaria mosquito: 91%; Canine: 91%; Chicken: 91%; Zebrafish: 91%; Southern house mosquito: 91%; Western clawed frog: 91%; Rat: 91%; Florida lancelet: 91%; Blood fluke: 91%; European domestic ferret: 91%; Atlantic salmon: 85%; Japanese pufferfish: 85%; Starlet sea anemone: 84%; Chimpanzee: 84%; Pig-tailed macaque: 84%; Rhesus macaque: 84%; Lowland gorilla: 84%; Pygmy chimpanzee: 84%; Western Gorilla: 78%; Red-chested mustached tamarin: 78%; Black-handed spider monkey: 78%; Bornean orangutan: 78%; Yellowfever mosquito: 78%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.