ZSCAN5D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191322

Catalog No. NBP191322

Description

ZSCAN5D Polyclonal specifically detects ZSCAN5D in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZSCAN5D
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: ZSCAN5D
• Immunogen: Synthetic peptide directed towards the middle region of human LOC646698. Peptide sequence RKNLNEHKLIHSGEKPYKCPKCLRAFRRPETLKYHQKTHQETTAPRECEG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: Putative zinc finger and SCAN domain-containing protein 5D, zinc finger and SCAN domain containing 5D, ZNF495D
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 646698
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only