Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZXDA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZXDA |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZXDA Polyclonal specifically detects ZXDA in Human samples. It is validated for Western Blot.Specifications
ZXDA | |
Polyclonal | |
Rabbit | |
NP_009087 | |
7789 | |
Synthetic peptide directed towards the middle region of human ZXDA. Peptide sequence PAKAEWSVHPNSDFFGQEGETQFGFPNAAGNHGSQKERNLITVTGSSFLV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
zinc finger X-linked protein ZXDA, zinc finger, X-linked, duplicated A, ZNF896 | |
ZXDA | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title