Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZXDB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP254712
Description
ZXDB Polyclonal specifically detects ZXDB in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
ZXDB | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1 - 4ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
zonadhesin | |
Rabbit | |
Immunogen affinity purified | |
RUO | |
158586 | |
Human | |
IgG |
Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
ZXDB | |
This antibody was developed against a Recombinant Protein corresponding to amino acids:DPPQSLDTSLFFGTAATGFQQSSLNMDEVSSVSVGPLGSLDSLAMKNSSPEPQAL | |
100 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction