Learn More
Description
Specifications
Specifications
| Antigen | Zyxin |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | CTCL tumor antigen se14-3, CTCL-associated antigen se14-3, cutaneous T-cell lymphoma associated antigen se14-3, Cutaneous T-cell lymphoma-associated antigen se14-3, KIAA1125, MGC31836, predicted protein of HQ2893, PRKCBP1, PRO2893, protein kinase C-binding protein 1, Rack7, RACK7protein kinase C binding protein 1, zinc finger MYND domain containing protein 8, Zinc finger MYND domain-containing protein 8, zinc finger, MYND-type containing 8 |
| Gene Symbols | ZYX |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a Recombinant Protein corresponding to amino acids:PKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAF |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
