Recombinant Proteins
- (91)
- (87)
- (1)
- (1)
- (68)
- (69)
- (2)
- (1)
- (13)
- (73)
- (69)
- (1)
Filtered Search Results
Novus Biologicals™ Glutamine Synthetase Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | SDS-PAGE |
| Purity or Quality Grade | >90% |
| Conjugate | Unconjugated |
| Common Name | Glutamine Synthetase |
| Molecular Weight (g/mol) | 44.2kDa |
| Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol, 5mM DTT, 200mM NaCl |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | SDS-PAGE |
Novus Biologicals™ Recombinant Human Glutamine Synthetase Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified and high bioactivity. Generating reliable and reproducible results.
| Purity or Quality Grade | >85%, by SDS-PAGE |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | cell proliferation-inducing protein 59, EC 4.1.1.15, EC 6.3.1.2, GLNSPIG59, Glutamate decarboxylase, glutamate-ammonia ligase, Glutamate--ammonia ligase, glutamate-ammonia ligase (glutamine synthase), glutamine synthase, glutamine synthetase, GS, PIG43, proliferation-inducing protein 43 |
| Biological Activity | Specific activity is > 2.000 pmol/min/ug, and is defined as the amount of enzyme that convert L-glutamate to L-glutamine per miunte at pH 7.5 at 37C coupled system with PK/LDH. |
| Common Name | Glutamine Synthetase |
| Molecular Weight (g/mol) | TMW: 42kDa |
| Gene ID (Entrez) | 2752 |
| Formulation | 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol, 1mM DTT, 0.1mM PMSF |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | SDS-PAGE |
| Recombinant | Recombinant |
Novus Biologicals™ Glutamine Synthetase Recombinant Protein Antigen
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein
Novus Biologicals™ Recombinant Human Glutamine Synthetase His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified and high bioactivity. Generating reliable and reproducible results. Applications: Functional, SDS-Page, Bioactivity
| Molecular Weight (g/mol) | 43.13 kDa |
|---|---|
| Species | Human |
| Source | E. coli |
Invitrogen™ Human Glutamine Synthetase (aa 68-208) Control Fragment Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | LQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGP |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human Glutamine Synthetase (aa 68-208) Control Fragment |
| Recombinant | Recombinant |
Invitrogen™ Human Glutamine Synthetase (aa 227-365) Control Fragment Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | RVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human Glutamine Synthetase (aa 227-365) Control Fragment |
| Recombinant | Recombinant |
R&D Systems™ Recombinant Mouse Transglutaminase 2/TGM2 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
R&D Systems™ Recombinant Human Transglutaminase 2/TGM2 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity
R&D Systems™ Recombinant Human Transglutaminase 7/TGM7 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
Invitrogen™ Human QRICH2 (aa 125-220) Control Fragment Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | TAHPSDGVSSREQSKVPSGTGRQQQPRARDEAGVPRLHQSSTFQFKSDSDRHRSREKLTSTQPRRNARPGPVQQDLPLARDQPSSVPASQSQVHLR |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human QRICH2 (aa 125-220) Control Fragment |
| Recombinant | Recombinant |
Novus Biologicals™ Recombinant Human GFPT1 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1, CMSTA1, GFA, GFAT, GFAT 1, GFAT1, GFAT1m, GFPT, GFPT1L, glutamine--fructose-6-phosphate transaminase 1, MSLG |
| Common Name | GFPT1 |
| Molecular Weight (g/mol) | TMW: 43.7kDa |
| Gene ID (Entrez) | 2673 |
| Formulation | 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 50% glycerol, 2mM DTT, 2mM EDTA |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | SDS-PAGE |
| Recombinant | Recombinant |
R&D Systems™ Recombinant Human Asparagine Synthetase/ASNS His Protein
Asparagine Synthetase (ASNS) represents a single mammalian-expressed enzyme that catalyzes the synthesis of asparagine and glutamate from aspartate and glutamine in an ATP-dependent amidotransferase reaction
| Molecular Weight (g/mol) | 49.8 kDa |
|---|---|
| Species | Human |
| Source | E. coli |
Novus Biologicals™ Recombinant Mouse Transglutaminase 2/TGM2 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Purity or Quality Grade | >85%, by SDS-PAGE |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | C polypeptide, EC 2.3.2.13, G-ALPHA-h, protein-glutamine gamma-glutamyltransferase 2, protein-glutamine-gamma-glutamyltransferase, TG(C), TG2, TGase C, TGase H, TGase-2, TGase-H, TGCGNAH, Tissue transglutaminase, transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase), Transglutaminase C, Transglutaminase H, Transglutaminase-2 |
| Common Name | Transglutaminase 2/TGM2 |
| Molecular Weight (g/mol) | TMW: 79.4kDa |
| Gene ID (Entrez) | 7052 |
| Formulation | Phosphate buffered saline (pH7.4) containing 10% glycerol, 1mM DTT |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| For Use With (Application) | SDS-PAGE |
| Recombinant | Recombinant |