Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

1,561 – 1,575 of 134,992 results

1,561

R&D Systems™ RQCD1 Protein

A Novus product, part of R&D Systems. Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	RQCD1
Molecular Weight (g/mol)	35.7kDa
Formulation	Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 1mM DTT, 10% glycerol
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	SDS-PAGE

1,562

Invitrogen™ Human PCOLCE (aa 298-373) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability

1,563

Invitrogen™ Human ZNF805 (aa 561-588) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability

1,564

R&D Systems™ Recombinant Human FBPase 1 His Protein

A Novus product, part of R&D Systems. Highly purified and high bioactivity. Generating reliable and reproducible results. Applications: Functional, SDS-Page, Bioactivity

Pricing & Availability
Specifications

Purity or Quality Grade	>90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	D-fructose-1,6-bisphosphate 1-phosphohydrolase 1, EC 3.1.3, EC 3.1.3.11, FBP, FBPase 1, fructose-1,6-bisphosphatase 1, fructose-bisphosphatase 1, growth-inhibiting protein 17
Biological Activity	Specific activity is > 7,000 pmol/min/ug obtained bymeasuring the increase of NADPH absorbance at 340 nm resulting from thereduction of NADP. One unit will oxidize 1.0 pmole of fructose 1,6 diphosphate to fructose 6-phosphate and inorganic phosphate per minute at pH 9.5 at 37C.
Common Name	FBPase 1
Molecular Weight (g/mol)	TMW: 39kDa
Gene ID (Entrez)	2203
Formulation	20mM Tris-HCl buffer (pH8.0) containing 1mM DTT, 10% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

1,565

MilliporeSigma™ TRAIL, Human, Recombinant Protein, E. coli

Pricing & Availability

1,566

Invitrogen™ Human ZFAND2A (aa 68-145) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability

1,567

Invitrogen™ Human FAM83C (aa 520-618) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability

1,568

Invitrogen™ Human DOCK10 (aa 310-404) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability

1,569

R&D Systems™ ADAT2 Protein

A Novus product, part of R&D Systems. Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	ADAT2
Molecular Weight (g/mol)	23.2kDa
Gene ID (Entrez)	134637
Immunogen	ADAT2, 1-191aa. MGSSHHHHHHSSGLVPRGSHMEAKAAPKPAASGACSVSAEETEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

1,570

Invitrogen™ Human GCC2 (aa 546-639) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability

1,571

Invitrogen™ Human SPECC1L (aa 884-940) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability

1,572

Invitrogen™ Human ZNF385B (aa 178-237) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability

1,573

Invitrogen™ Human EMID1 (aa 34-172) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability

1,574

Gibco™ Human LD78 beta (CCL3L1) Recombinant Protein, PeproTech®

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-20°C
Purity or Quality Grade	≥ 98% by SDS-PAGE gel and HPLC analyses.
Conjugate	Unconjugated
Form	Lyophilized
Common Name	CCL3L1
Molecular Weight (g/mol)	7.7 kDa
Gene Symbol	CCL3L1
Endotoxin Concentration	<1 EU/μg
Sequence	APLAADTPTA CCFSYTSRQI PQNFIADYFE TSSQCSKPSV IFLTKRGRQV CADPSEEWVQ KYVSDLELSA
Expression System	E. coli
For Use With (Application)	Bioactivity,Control,Western Blot Control
Source	E. coli
Name	Human LD78 beta (CCL3L1)
Accession Number	P16619
Gene Alias	464.2; C-C motif chemokine 3-like 1; C-C motif chemokine ligand 3 like 1; CC-chemokine (CCL3); MIP1a; CCL3L1; CCL3L3; chemokine (C-C motif) ligand 3-like 1; chemokine ligand 3-like 1; D17S1718; G0/G1 switch regulatory protein 19-2; G0S19-2; LD78; LD78BETA; LD78-beta(1-70); LD78-beta(3-70); LD78-beta(5-70); macrophage inflamatory protein 1 alpha; MIP1AP; PAT 464.2; SCYA3L; SCYA3L1; small inducible cytokine A3-like 1; Small-inducible cytokine A3-like 1; Tonsillar lymphocyte LD78 beta protein
Biological Activity	Determined by its ability to chemoattract mouse BaF3 cells expressing the CCR5 receptor using a concentration range of 5.0-25.0 ng/ml
Gene ID (Entrez)	6349
Formulation	Protein with no preservative
Recombinant	Recombinant

1,575

Invitrogen™ Human C1QBP (aa 107-188) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability

Recombinant Proteins

Filtered Search Results

Narrow Results