Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

4,561 – 4,575 of 115,743 results

4,561

R&D Systems™ Recombinant Human Chymase/CMA1 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

4,562

R&D Systems™ Recombinant Mouse Galectin-2 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

4,563

Novus Biologicals™ EIF1AX Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	EIF1AX
Molecular Weight (g/mol)	18.6kDa
Gene ID (Entrez)	1964
Formulation	Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 40% glycerol, 5mM DTT, 200mM NaCl
Immunogen	MGSSHHHHHHSSGLVPRGSHMPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

4,564

R&D Systems™ Recombinant Human TINAGL1 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

4,565

R&D Systems™ Recombinant Cynomolgus Monkey 5T4 Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

4,566

Novus Biologicals™ GLYAT Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

4,567

R&D Systems™ Recombinant Rat B7-2/CD86 Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

4,568

Novus Biologicals™ FKBPL Protein

Highly purified and high bioactivity. Generating reliable and reproducible results. Applications: Functional, SDS-Page, Bioactivity

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	FKBPL
Molecular Weight (g/mol)	39.2kDa
Formulation	Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol, 2mM DTT, 100mM NaCl
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

4,569

R&D Systems™ Recombinant Human Semaphorin 4G Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

4,570

Novus Biologicals™ PMM1/Phosphomannomutase 1 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	PMM1/Phosphomannomutase 1
Molecular Weight (g/mol)	31.9kDa
Formulation	Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 2mM DTT, 100mM NaCl, 0.1mM PMSF
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE

4,571

R&D Systems™ Recombinant Human GDF-7 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

4,572

R&D Systems™ Recombinant SARS-CoV-2 B.1.351 S RBD His Avi-tag Protein

Beta Variant (South Africa), K417N, E484K, N501Y

Pricing & Availability

4,573

Novus Biologicals™ MDH2 Protein

Highly purified and high bioactivity. Generating reliable and reproducible results. Applications: Functional, SDS-Page, Bioactivity

Pricing & Availability
Specifications

Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	MDH2
Molecular Weight (g/mol)	36kDa
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	ELISA,Western Blot
Source	Recombinant human MDH2 protein, fused to His-tag at N-terminus, expressed in E. coli
Accession Number	NP_005909
Regulatory Status	RUO
Purification Method	Protein
Gene ID (Entrez)	4191
Formulation	Liquid. In 20mM Tris-HCl Buffer (pH 7.5) containing 10% Glycerol
Immunogen	MDH2, 25-338aa, Human, His tag, E. coli (NP_005909).
Recombinant	Recombinant

4,574

MilliporeSigma™ Calmodulin, Human Brain, Protein

Pricing & Availability

4,575

R&D Systems™ Recombinant Mouse Twisted Gastrulation (TSG) Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability
Specifications

Purity or Quality Grade	95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	23.5 kDa
Gene ID (Entrez)	65960
Quantity	50 μg
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	Mouse myeloma cell line,NS0-derived mouse TSG protein Cys25-Phe222,with a C-terminal 10-His tag
Recombinant	Recombinant
Name	TSG

Prev
1
...
303
304
305
306
...
7,717
Next

Welcome to fishersci.com

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ EIF1AX Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ GLYAT Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ FKBPL Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ PMM1/Phosphomannomutase 1 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ MDH2 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ EIF1AX Protein

Novus Biologicals™ GLYAT Protein

Novus Biologicals™ FKBPL Protein

Novus Biologicals™ PMM1/Phosphomannomutase 1 Protein

Novus Biologicals™ MDH2 Protein