Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

496 – 510 of 119,908 results

496

Invitrogen™ Human AURKB (Aurora B), His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Shipping Condition	Dry Ice
Conjugate	Unconjugated
Form	Liquid
pH Range	7.5
Common Name	Aurora B
Molecular Weight (g/mol)	43.4 kDa
KinaseFamily	Aurora Kinase Family
Gene Symbol	AURKB
Sequence	Full length
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human AURKB (Aurora B), His Tag
Accession Number	Q96GD4
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	Aik2; AIM1; AIM-1; AIRK2; AL022959; ARK2; ARK-2; AurB; AURKB; aurkb-sv1; aurkb-sv2; aurora 1; aurora- and IPL1-like midbody-associated protein 1; aurora B; aurora kinase B; aurora kinase B-Sv1; aurora kinase B-Sv2; aurora/IPL1-related kinase 2; aurora-1; aurora-B; aurora-related kinase 2; IPL1; PPP1R48; protein phosphatase 1, regulatory subunit 48; serine/threonine kinase; serine/threonine kinase 12; serine/threonine kinase 5; Serine/threonine-protein kinase 12; Serine/threonine-protein kinase 5; serine/threonine-protein kinase aurora-B; STK1; STK-1; Stk12; STK12; AIK2; AIM1; ARK2; IPL1; AIM-1; STK5
Protein Form	Recombinant, Full Length
Product Type	Protein
Gene ID (Entrez)	9212
Formulation	50mM tris with 50% glycerol, 0.02% Triton X-100, 150mM NaCl, 0.5mM EDTA, 2mM DTT and no preservative; pH 7.5
Protein Tag	His-tag
Species	Human
Recombinant	Recombinant

497

Invitrogen™ Human LRRK2 [R1441C], GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	For research use only. Not for use in diagnostic procedures
Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	204.8 kDa
Formulation	50 mM tris with no preservative
Sequence	Catalytic domain [R1441C]
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human LRRK2 [R1441C], GST Tag
Recombinant	Recombinant

498

Invitrogen™ Human FYN A, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	87.1 kDa
Formulation	50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5
Sequence	Full length
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human FYN A, GST Tag
Recombinant	Recombinant

499

Invitrogen™ Human TEX264 (aa 107-184) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	PSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPL
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human TEX264 (aa 107-184) Control Fragment
Recombinant	Recombinant

500

Invitrogen™ Human FGFR2, His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
pH Range	7.5
Common Name	FGFR2
Molecular Weight (g/mol)	52.1 kDa
KinaseFamily	FGF Receptor Kinase Family
Kinase Group	Tyrosine Kinases
Expression System	Baculovirus
For Use With (Application)	Kinase Assay
Name	Human FGFR2, His Tag
Purification Method	Purified
Gene Alias	AU043015; AW556123; bacteria-expressed kinase; BBDS; BEK; BEK fibroblast growth factor receptor; BFR-1; CD332; CEK3; CFD1; ECT1; FGF Receptor; FGF Receptor 2; FGF-10; FGFR; FGFR2; FGFR-2; Fgfr7; Fgfr-7; fibroblast growth factor receptor 2; JWS; Keratinocyte growth factor receptor; KGFR; KGFRTr; KSAM; K-SAM; protein tyrosine kinase, receptor like 14; Soluble KGFR; svs; TK14; TK25
Protein Form	Recombinant, Catalytic Domain, Cytoplasmic
Formulation	50mM tris with 150mM NaCl, 50% glycerol, 0.5mM EDTA, 0.04% Triton X-100, 4mM DTT and no preservative; pH 7.5
Species	Human
Recombinant	Recombinant
Shipping Condition	Dry Ice
Gene Symbol	FGFR2
Sequence	403-822
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Concentration	See Label
Accession Number	P21802
Regulatory Status	RUO
Product Type	Protein
Gene ID (Entrez)	2263
Protein Tag	His-tag

501

Invitrogen™ Human AXL, His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
pH Range	7
Form	Liquid
Molecular Weight (g/mol)	48.3 kDa
Common Name	AXL
Gene Symbol	AXL
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Sequence	473-end
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human AXL, His Tag
Accession Number	P30530
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	Adhesion-related kinase; AI323647; ARK; AXL; AXL oncogene; AXL receptor tyrosine kinase; AXL transforming sequence/gene; AZF1; JTK11; oncogene AXL; sAXL; soluble AXL; Tyro7; Tyrosine-protein kinase receptor UFO; Ufo; ufo oncogene homolog
Product Type	Protein
Gene ID (Entrez)	558
Formulation	50mM sodium phosphate with 0.1mM PMSF, 300mM NaCl, 25% glycerol, 150mM Imidazole, 0.2mM DTT and no preservative; pH 7
Protein Tag	His-tag
Recombinant	Recombinant

502

Invitrogen™ Human CDK2/cyclin E1, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	CDK2
Molecular Weight (g/mol)	60.2-73.4 kDa
Concentration	See Label
Expression System	Baculovirus
For Use With (Application)	Kinase Assay
Name	Human CDK2/cyclin E1, GST Tag
Accession Number	P24941
Gene Alias	A630093N05Rik; CDC28; CDC2A; cdc2-related protein kinase; CDK1; CDK2; CDKN2; Cell division protein kinase 2; cyclin dependent kinase 2; cyclin dependent kinase 2-alpha; cyclin-dependent kinase 2; EC 2.7.11.22; EC 2.7.11.23; kinase Cdc2; MPF; p33 protein kinase; p33(CDK2); p33CDK2; p34 protein kinase
Protein Length	1-298
Gene ID (Entrez)	1017
Formulation	50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

503

Invitrogen™ Human CHUK (IKK Alpha), His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
pH Range	7.5
Common Name	IKK alpha
Molecular Weight (g/mol)	88.7 kDa
KinaseFamily	IKK Kinase Family
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human CHUK (IKK Alpha), His Tag
Purification Method	Purified
Gene Alias	AI256658; CHUK; Chuk1; component of inhibitor of nuclear factor kappa B kinase complex; conserved helix-loop-helix ubiquitous kinase; EC 2.7.11.10; Fbx24; Fbxo24; FLJ40509; I kappa B kinase 1; i kappa-B kinase alpha; ikappaB kinase; I-kappa-B kinase 1; I-kappa-B kinase 2; IkappaB kinase alpha; I-kappa-B kinase alpha; I-kappa-B kinase-alpha; IkB kinase alpha subunit; IkB kinase-alpha; ikBKA; IKBKB; IKK alpha; IKK1; IKK2; Ikka; IKK-A; IKK-a kinase; IKK-alpha; IKKB; IKK-B; IKK-beta; Inhibitor of nuclear factor kappa-B kinase subunit alpha; kinase beta; MGC131801; NFKBIKA; NFKBIKB; Nuclear factor NFkappaB inhibitor kinase alpha; Nuclear factor NF-kappa-B inhibitor kinase alpha; TCF16; TCF-16; Transcription factor 16
Protein Form	Recombinant, Full Length
Formulation	50mM tris HCl with 150mM NaCl, 2mM DTT, 0.02% Triton X-100, 50% glycerol, 0.5mM EDTA and no preservative; pH 7.5
Species	Human
Recombinant	Recombinant
Shipping Condition	Dry Ice
Gene Symbol	CHUK
Sequence	Full length
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Concentration	See Label
Protein Subtype	Serine/Threonine Kinases
Accession Number	O15111
Regulatory Status	RUO
Product Type	Protein
Gene ID (Entrez)	1147
Protein Tag	His-tag

504

Invitrogen™ Human CAMK2A (CaMKII Alpha), His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
pH Range	7.5
Common Name	CaMKII alpha
Molecular Weight (g/mol)	56.8 kDa
KinaseFamily	CAMK2 Kinase Family
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human CAMK2A (CaMKII Alpha), His Tag
Purification Method	Purified
Gene Alias	alpha CaM kinase II; alpha-CaMKII; Ca2+/calmodulin-dependent protein kinase II; Ca2+/calmodulin-dependent protein kinase II alpha; Calci; calcium/calmodulin dependent protein kinase II alpha; calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha; calcium/calmodulin-dependent protein kinase II alpha; calcium/calmodulin-dependent protein kinase II alpha subunit; calcium/calmodulin-dependent protein kinase II alpha-B subunit; calcium/calmodulin-dependent protein kinase type II alpha chain; calcium/calmodulin-dependent protein kinase type II subunit alpha; CaM kinase II alpha subunit; caM kinase II subunit alpha; CaMK II; CAMK2; Camk2a; CAMKA; CaMKII; CaMK-II alpha subunit; caMK-II subunit alpha; CaMKIINalpha; CaM-kinase II alpha chain; EC 2.7.11.17; KIAA0968; mKIAA0968; OTTHUMP00000165787; OTTHUMP00000165788; Phospho-CaMKI; PK2CDD; PKCCD; R74975
Protein Form	Recombinant, Full Length
Formulation	20mM tris with 50% glycerol, 100mM NaCl, 0.5mM EDTA, 2mM DTT, 0.05% NP-40 and no preservative; pH 7.5
Research Category	Signal Transduction
Species	Human
Recombinant	Recombinant
Shipping Condition	Dry Ice
Gene Symbol	CAMK2A
Sequence	Full length
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Concentration	See Label
Protein Subtype	Serine/Threonine Kinases
Accession Number	Q9UQM7
Regulatory Status	RUO
Product Type	Protein
Gene ID (Entrez)	815
Protein Tag	His-tag

505

Invitrogen™ Human KDR (VEGFR2), His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Common Name	FLK1 (VEGF Receptor 2)
Molecular Weight (g/mol)	68.4 kDa
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human KDR (VEGFR2), His Tag
Accession Number	P35968
Gene Alias	6130401C07; CD309; CD309 antigen; fetal liver kinase 1; fetal liver kinase-1; FLK1; Flk-1; FLK1 kinase insert domain receptor (a type III receptor tyrosine kinase) (VEGF receptor 2); FLK1 kinase insert domain receptor (VEGF receptor 2); flk-1 type VEGF receptor; KDR; kinase insert domain protein receptor; kinase insert domain receptor; kinase insert domain receptor (a type III receptor tyrosine kinase); kinase NYK; Krd-1; Ly73; protein-tyrosine kinase receptor flk-1; sCD309; soluble CD309; soluble vascular endothelial growth factor receptor 2; soluble VEGFR 2; soluble VEGFR2; sVEGFR-2; tyrosine kinase growth factor receptor; vascular endotheial growth factor 2; vascular endothelial growth factor receptor 2; vascular endothelial growth factor receptor- 2; vascular endothelial growth factor receptor-2; vascular endothelial growth factor receptor-3; VEGF R2; VEGF receptor-2; VEGFR; VEGFR2; VEGFR-2
Gene ID (Entrez)	3791
Protein Tag	His-tag
Species	Human
Recombinant	Recombinant

506

Invitrogen™ Human PIM1, His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	For research use only. Not for use in diagnostic procedures
Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	40.7 kDa
Formulation	50 mM tris HCl with 0.05% Triton X-100, 0.5 mM EDTA, 2 mM DTT, 50% glycerol, 500 mM NaCl and no preservative; pH 7.5
Sequence	Full length
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human PIM1, His Tag
Recombinant	Recombinant

507

Invitrogen™ Human RPS6KA3 (RSK2), His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Shipping Condition	Dry Ice
Conjugate	Unconjugated
Form	Liquid
pH Range	7.5
Common Name	RSK2
Molecular Weight (g/mol)	86.3 kDa
KinaseFamily	RSK (RPS6K) Kinase Family
Gene Symbol	RPS6KA3
Sequence	Full length
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Concentration	See Label
Expression System	Baculovirus
For Use With (Application)	Kinase Assay
Name	Human RPS6KA3 (RSK2), His Tag
Accession Number	P51812
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	90 kDa ribosomal protein S6 kinase 3; C130006E23; CLS; HU-3; Insulin-stimulated protein kinase 1; ISPK1; ISPK-1; MAP kinase-activated protein kinase 1b; MAPK-activated protein kinase 1b; MAPKAP kinase 1b; MAPKAPK1B; MAPKAPK-1b; MPK-9; MRX19; p90-RSK 3; p90-RSK2; p90RSK3; pp90RSK2; RGD1563860; ribosomal protein S6 kinase 2; ribosomal protein S6 kinase A3; ribosomal protein S6 kinase alpha-3; ribosomal protein S6 kinase polypeptide 3; ribosomal protein S6 kinase, 90kDa, polypeptide 3; ribosomal S6 kinase 2; Rps6ka3; Rps6ka-rs1; RSK; Rsk2; RSK-2; S6K-alpha3; S6K-alpha-3
Product Type	Protein
Gene ID (Entrez)	6197
Formulation	50mM tris with 2mM DTT, 150mM NaCl, 0.05mM EDTA, 50% glycerol, 0.05% Triton X-100 and no preservative; pH 7.5
Protein Tag	His-tag
Species	Human
Recombinant	Recombinant

508

Invitrogen™ Human AKT2 (PKB beta), His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	For research use only. Not for use in diagnostic procedures
Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	59.1 kDa
Formulation	20 mM tris with 0.01% Triton X-100, 0.1 mM sodium orthovanadate, 0.5 mM EDTA, 150 mM NaCl, 20% glycerol, 2 mM DTT and no preservative; pH 7.5
Sequence	Full length
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human AKT2 (PKB beta), His Tag
Recombinant	Recombinant

509

Invitrogen™ Human IGF1R, His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	For research use only. Not for use in diagnostic procedures
Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	48.9 kDa
Formulation	50 mM tris with 0.05% Triton X-100, 0.05 mM EDTA, 100 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human IGF1R, His Tag
Recombinant	Recombinant

510

Invitrogen™ Human MAPK13 (p38 delta), His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
Common Name	SAPK4
Molecular Weight (g/mol)	46.2 kDa
KinaseFamily	MAP Kinase Family
Sequence	Full length
Concentration	See Label
Expression System	Baculovirus
For Use With (Application)	Kinase Assay
Name	Human MAPK13 (p38 delta), His Tag
Accession Number	O15264
Gene Alias	im:7136778; MAP kinase 13; MAP kinase p38 delta; MAPK 13; Mapk13; MAPK-13; mitogen activated protein kinase 13; mitogen-activated protein kinase 13; Mitogen-activated protein kinase p38 delta; p38 delta MAP kinase; p38delta; PRKM13; SAPK/Erk/kinase 4; SAPK4; Serk4; Stress-activated protein kinase 4
Gene ID (Entrez)	5603
Protein Tag	His-tag
Species	Human
Recombinant	Recombinant

Prev
1
...
32
33
34
35
...
7,994
Next

Recombinant Proteins

Filtered Search Results

Narrow Results