accessibility menu, dialog, popup

UserName
Viewing profile as user:

Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
For Use With (Application) 
  • (2)
  • (970)
  • (1)
  • (23,544)
  • (5)
  • (1)
  • (1)
  • (67)
  • (220)
  • (4,416)
  • (23)
  • (1)
  • (4)
  • (2)
  • (13)
  • (21,464)
  • (3)
  • (4)
  • (3)
  • (1)
  • (2)
  • (4)
  • (14)
  • (71)
  • (2)
  • (2)
  • (2)
  • (1)
  • (3)
  • (2)
  • (1)
  • (3)
  • (4)
  • (1)
  • (1)
  • (1)
  • (3)
  • (254)
  • (22,718)
  • (1)
  • (1)
  • (2)
  • (1)
  • (13)
  • (26,220)
  • (265)
  • (32)
  • (3)
  • (708)
  • (14)
  • (2)
  • (1)
  • (8)
  • (1)
  • (5)
  • (1)
  • (108)
  • (1)
  • (3,924)
  • (1,408)
  • (3)
  • (4)
  • (5)
  • (5)
  • (1)
  • (1)
  • (1)
  • (1)
  • (14)
  • (137)
  • (48)
  • (6)
  • (17)
  • (2)
  • (1)
  • (4)
  • (82)
  • (12)
  • (2)
  • (3)
  • (86)
  • (4)
  • (113)
  • (96)
  • (19)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1,525)
  • (2)
  • (1)
  • (3)
  • (18)
  • (48)
  • (3)
  • (1)
  • (2)
  • (9)
  • (27)
  • (2)
  • (199)
  • (1)
  • (4)
  • (1)
  • (2)
  • (114)
  • (44)
  • (2)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1)
  • (3)
  • (1)
  • (23,710)
  • (6)
  • (3)
  • (1)
  • (1)
  • (63)
  • (6)
  • (2)
  • (7)
  • (5)
  • (1)
  • (2)
  • (1)
  • (1)
  • (6,726)
  • (6)
  • (4)
  • (1)
  • (3)
  • (1)
  • (4)
  • (2)
  • (13)
  • (17)
  • (1)
  • (3)
  • (3)
  • (4)
  • (26,017)
  • (237)
  • (1)
  • (3)
Recombinant 
  • (286)
  • (2)
  • (62,014)
  • (1)
Form 
  • (15)
  • (1)
  • (2)
  • (45,312)
  • (5,865)
  • (245)
  • (168)
  • (56)
  • (3,364)
Species 
  • (2)
  • (1)
  • (2)
  • (1)
  • (21)
  • (560)
  • (96)
  • (2)
  • (1)
  • (1)
  • (2)
  • (1)
  • (27)
  • (1)
  • (8)
  • (15)
  • (1)
  • (72)
  • (1)
  • (1,139)
  • (1)
  • (3)
  • (16)
  • (1)
  • (3)
  • (1)
  • (1)
  • (1)
  • (8)
  • (1)
  • (4)
  • (1)
  • (1)
  • (26,027)
  • (5)
  • (1)
  • (4)
  • (582)
  • (2)
  • (1)
  • (1)
  • (3)
  • (1)
  • (1)
  • (14)
  • (32)
  • (24)
  • (1)
  • (2)
  • (16)
  • (120)
  • (9)
  • (2)
  • (1)
  • (2)
  • (2)
  • (2)
  • (23)
  • (5)
  • (3)
  • (3)
  • (2)
  • (14)
  • (23,575)
  • (1)
  • (50)
Conjugate 
  • (7)
  • (1)
  • (3)
  • (18)
  • (2)
  • (62)
  • (1)
  • (4)
  • (2)
  • (9)
  • (59)
  • (1)
  • (2)
  • (3)
  • (1)
  • (391)
  • (1)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (3)
  • (2)
  • (6)
  • (19)
  • (7)
  • (2)
  • (2)
  • (3)
  • (46)
  • (1)
  • (1)
  • (1)
  • (2)
  • (5)
  • (1)
  • (1)
  • (1)
  • (2)
  • (8)
  • (2)
  • (3)
  • (39,212)
  • (1)
  • (11)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

special offers

  • (9)
  • (2,534)

brands

  • (157)
  • (5,921)
  • (5)
  • (13)
  • (3)
  • (2)
  • (7,394)
  • (2)
  • (25,790)
  • (1)
  • (1)
  • (2)
  • (140)
  • (1)
  • (309)
  • (5)
  • (15)
  • (1)
  • (4)
  • (1)
  • (12)
  • (11)
  • (1)
  • (1)
  • (1)
  • (1)
  • (167)
  • (86)
  • (21)
  • (1)
  • (1)
  • (1)
  • (3)
  • (18)
  • (2)
  • (380)
  • (2)
  • (1)
  • (11)
  • (3)
  • (1)
  • (1)
  • (1)
  • (67)
  • (2)
  • (10)
  • (1)
  • (2)
  • (6)
  • (1)
  • (48)
  • (2)
  • (62)
  • (27)
  • (17)
  • (1)
  • (1)
  • (1)
  • (8)
  • (5)
  • (8)
  • (152)
  • (1)
  • (15)
  • (1)
  • (4)
  • (2,203)
  • (1)
  • (3,159)
  • (1)
  • (33)
  • (3,404)
  • (233)
  • (513)
  • (667)
  • (200)
  • (1)
  • (222)
  • (770)
  • (2,035)
  • (14)
  • (1)
  • (2)
  • (12)
  • (274)
  • (2)
  • (2)
  • (2)
  • (11)
  • (1)
  • (2)
  • (1)
  • (2)
  • (34)
  • (2)
  • (3)
  • (9)
  • (2)
  • (1)
  • (20)
  • (752)
  • (16)
  • (37)
  • (63)
  • (1)
  • (7)
  • (2)
  • (34)
  • (1)
  • (1)
  • (9)
  • (2)
  • (2)
  • (118)
  • (40)
  • (3)
  • (25)
  • (1)
  • (8)
  • (576)
  • (2)
  • (7)
  • (43)
  • (1)
  • (878)
  • (2)
  • (4)
  • (12)
  • (12)
  • (14)
  • (1)
  • (1)
  • (5)
  • (15)
  • (1)
  • (16)
  • (5)
  • (1)
  • (2)
  • (6)
  • (2)
  • (550)
  • (359)
  • (4)
  • (1)
  • (2)
  • (1)
  • (73)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (8)
  • (1)
  • (15)
  • (1)
  • (1)
  • (34)
  • (28)
  • (3)
  • (1)
  • (2)
  • (58)
  • (9)
  • (1)
  • (1)
  • (1)
  • (1)
  • (652)
  • (22,967)
  • (42)
  • (6)
  • (19)
  • (15)
  • (1)
  • (536)
  • (1)
  • (14)
  • (1)
  • (7)
  • (1)
  • (8)
  • (2)
  • (24)
  • (2)
  • (3)
  • (1)
  • (1)
  • (1)
  • (254)
  • (1)
  • (1)
  • (1)
  • (1)
  • (4)
  • (4,736)
  • (1)
  • (65)
  • (1)
  • (1)
  • (616)
  • (2)
  • (3)
  • (1)
  • (39)
  • (1)
  • (2)
  • (27)
  • (1)
  • (1)
  • (6,612)
  • (1)
  • (157)
  • (30)
  • (1)
  • (4,431)
  • (1)
  • (3)
  • (8)
  • (15)
  • (3)
  • (1)
  • (1)
  • (2)
  • (3)
  • (1)
  • (178)
  • (1)
  • (1)
  • (1)
  • (16)
  • (8)
  • (7,331)
  • (1)
  • (29)
  • (3)
  • (1)
  • (22)
  • (184)
  • (2)
  • (31)
  • (323)
  • (9)
  • (121)
  • (4)
  • (3)
  • (11)
  • (1)
  • (506)
  • (3)
  • (15,178)
  • (2)
  • (19)
  • (3)
  • (1)
  • (1)
  • (7)
  • (3)
  • (4)
  • (1)
  • (24)
  • (4)
  • (7)
  • (2)
  • (1)
  • (3)
  • (1)
  • (567)
  • (84)
  • (27)
  • (2)
  • (34)
  • (1)
  • (1)
  • (4)
  • (2)
  • (10)
  • (2)
  • (12)
  • (2)
  • (117)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (11)
  • (6)
  • (1)
  • (5)
  • (5)
  • (139)
  • (13)

special interests

  • (244)
  • (584)
  • (40)
  • (6)
  • (8)
  • (17,896)

For Use With (Application)

  • (2)
  • (970)
  • (1)
  • (23,544)
  • (5)
  • (1)
  • (1)
  • (67)
  • (220)
  • (4,416)
  • (23)
  • (1)
  • (4)
  • (2)
  • (13)
  • (21,464)
  • (3)
  • (4)
  • (3)
  • (1)
  • (2)
  • (4)
  • (14)
  • (71)
  • (2)
  • (2)
  • (2)
  • (1)
  • (3)
  • (2)
  • (1)
  • (3)
  • (4)
  • (1)
  • (1)
  • (1)
  • (3)
  • (254)
  • (22,718)
  • (1)
  • (1)
  • (2)
  • (1)
  • (13)
  • (26,220)
  • (265)
  • (32)
  • (3)
  • (708)
  • (14)
  • (2)
  • (1)
  • (8)
  • (1)
  • (5)
  • (1)
  • (108)
  • (1)
  • (3,924)
  • (1,408)
  • (3)
  • (4)
  • (5)
  • (5)
  • (1)
  • (1)
  • (1)
  • (1)
  • (14)
  • (137)
  • (48)
  • (6)
  • (17)
  • (2)
  • (1)
  • (4)
  • (82)
  • (12)
  • (2)
  • (3)
  • (86)
  • (4)
  • (113)
  • (96)
  • (19)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1,525)
  • (2)
  • (1)
  • (3)
  • (18)
  • (48)
  • (3)
  • (1)
  • (2)
  • (9)
  • (27)
  • (2)
  • (199)
  • (1)
  • (4)
  • (1)
  • (2)
  • (114)
  • (44)
  • (2)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1)
  • (3)
  • (1)
  • (23,710)
  • (6)
  • (3)
  • (1)
  • (1)
  • (63)
  • (6)
  • (2)
  • (7)
  • (5)
  • (1)
  • (2)
  • (1)
  • (1)
  • (6,726)
  • (6)
  • (4)
  • (1)
  • (3)
  • (1)
  • (4)
  • (2)
  • (13)
  • (17)
  • (1)
  • (3)
  • (3)
  • (4)
  • (26,017)
  • (237)
  • (1)
  • (3)

Recombinant

  • (286)
  • (2)
  • (62,014)
  • (1)

Form

  • (15)
  • (1)
  • (2)
  • (45,312)
  • (5,865)
  • (245)
  • (168)
  • (56)
  • (3,364)

Species

  • (2)
  • (1)
  • (2)
  • (1)
  • (21)
  • (560)
  • (96)
  • (2)
  • (1)
  • (1)
  • (2)
  • (1)
  • (27)
  • (1)
  • (8)
  • (15)
  • (1)
  • (72)
  • (1)
  • (1,139)
  • (1)
  • (3)
  • (16)
  • (1)
  • (3)
  • (1)
  • (1)
  • (1)
  • (8)
  • (1)
  • (4)
  • (1)
  • (1)
  • (26,027)
  • (5)
  • (1)
  • (4)
  • (582)
  • (2)
  • (1)
  • (1)
  • (3)
  • (1)
  • (1)
  • (14)
  • (32)
  • (24)
  • (1)
  • (2)
  • (16)
  • (120)
  • (9)
  • (2)
  • (1)
  • (2)
  • (2)
  • (2)
  • (23)
  • (5)
  • (3)
  • (3)
  • (2)
  • (14)
  • (23,575)
  • (1)
  • (50)

Conjugate

  • (7)
  • (1)
  • (3)
  • (18)
  • (2)
  • (62)
  • (1)
  • (4)
  • (2)
  • (9)
  • (59)
  • (1)
  • (2)
  • (3)
  • (1)
  • (391)
  • (1)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (3)
  • (2)
  • (6)
  • (19)
  • (7)
  • (2)
  • (2)
  • (3)
  • (46)
  • (1)
  • (1)
  • (1)
  • (2)
  • (5)
  • (1)
  • (1)
  • (1)
  • (2)
  • (8)
  • (2)
  • (3)
  • (39,212)
  • (1)
  • (11)

Format

  • (2)
  • (1)
  • (1)

Boiling Point

  • (1)
  • (2)

Molecular Weight (g/mol)

  • (2)
  • (1)

Percent Purity

  • (3)

Quantity

  • (1)
  • (1)
  • (1)
676 – 690 of 115,939 results
676

Novus Biologicals™ Recombinant Human SPINK7 His Protein
SDP

Highly purified. Generating reliable and reproducible results.

678

Novus Biologicals™ Mycobacterium Tuberculosis ESAT6 Protein
SDP

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

679

R&D Systems™ Recombinant Human IFN-alpha-1b Protein

Accession Number CAA23799.1
Purity or Quality Grade >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie™ Blue Staining.
Conjugate Unconjugated
Molecular Weight (g/mol) MolecularWeight-observed: 17-21 kDa, under reducing conditions., MolecularWeight-theroretical: 19 kDa
Gene ID (Entrez) 3439
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.
Reconstitution Reconstitute at 100 μg/mL in PBS.
Endotoxin Concentration <0.10 EU / 1 μg of the protein by the LAL method.
Storage Requirements Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20°C to -70°C as supplied. 1 month, 2°C to 8°C under sterile conditions after reconstitution. 3 months, -20°C to -70°C under sterile conditions after reconstitution.
For Use With (Application) Bioactivity
Protein IFN-alpha 1
Source Human embryonic kidney cell, HEK293-derived human IFN-alpha 1 protein Cys24-Glu189
680

Novus Biologicals™ RGS2 Protein
SDP

Highly purified. Generating reliable and reproducible results.

Regulatory Status RUO
Purification Method SDS-PAGE
Purity or Quality Grade >90%
Conjugate Unconjugated
Common Name RGS2
Molecular Weight (g/mol) 26.5kDa
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 2mM DTT, 0.1M NaCl.
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
Concentration 0.25mg/mL
For Use With (Application) SDS-PAGE
681

Novus Biologicals™ Recombinant Human beta Sarcoglycan His Protein
SDP

Highly purified. Generating reliable and reproducible results.

Purity or Quality Grade >90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate Unconjugated
Gene Alias 43 kDa dystrophin-associated glycoprotein, 43DAG, A3bbeta-SG, beta-sarcoglycan, beta-sarcoglycan(43kD dystrophin-associated glycoprotein), Beta-SG, LGMD2E, limb girdle muscular dystrophy 2E (non-linked families), sarcoglycan, beta (43kD dystrophin-associated glycoprotein), sarcoglycan, beta (43kDa dystrophin-associated glycoprotein), SGC
Common Name beta Sarcoglycan
Molecular Weight (g/mol) TMW: 27.8kDa
Gene ID (Entrez) 6443
Formulation 20mM Tris-HCl buffer(pH8.0) containing 10% glycerol
Storage Requirements Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration 0.5mg/mL
For Use With (Application) SDS-PAGE
Recombinant Recombinant
682

R&D Systems™ Recombinant Human IFNA16 Protein

Accession Number P05015.1
Purity or Quality Grade >90%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie™ Blue Staining.
Conjugate Unconjugated
Gene Alias BC114392, Gm13280, Ifna6T, IFN-alpha 16, IFNalpha WA, IFN-alpha WA, IFN-alpha-16, IFN-alpha-N-protein, IFN-alphaO, IFN-alpha-WA, Ifnat6, interferon alpha-16, Interferon alpha-WA, interferon, alpha 16
Molecular Weight (g/mol) M.W.-observed: 18-22 kDa, under reducing conditions., M.W.-theroretical: 19 kDa
Gene ID (Entrez) 3449
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.
Reconstitution Reconstitute at 100 μg/mL in PBS.
Endotoxin Concentration <0.10 EU / 1 μg of the protein by the LAL method.
Storage Requirements Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20°C to -70°C as supplied. 1 month, 2°C to 8°C under sterile conditions after reconstitution. 3 months, -20°C to -70°C under sterile conditions after reconstitution.
For Use With (Application) Bioactivity
Protein IFN-alpha WA/IFNA16
Source Human embryonic kidney cell, HEK293-derived human IFNA16 protein Cys24-Asp189
683

Novus Biologicals™ GCLM Protein
SDP

Highly purified. Generating reliable and reproducible results.

Regulatory Status RUO
Purification Method SDS-PAGE
Purity or Quality Grade >90%
Conjugate Unconjugated
Common Name GCLM
Storage Requirements Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
For Use With (Application) SDS-PAGE
Source Human
684

Novus Biologicals™ Recombinant Human Protein phosphatase 1F His Protein
SDP

Highly purified. Generating reliable and reproducible results.

685

R&D Systems™ Recombinant Cynomolgus/Rhesus Macaque BTLA Fc Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

687

Novus Biologicals™ PSMG3 Protein
SDP

Highly purified. Generating reliable and reproducible results.

Regulatory Status RUO
Purification Method Protein
Purity or Quality Grade >90%
Conjugate Unconjugated
Common Name PSMG3
Molecular Weight (g/mol) 15.2kDa
Gene ID (Entrez) 84262
Formulation Liquid. In 20mM Tris-HCl Buffer (pH 8.0) containing 10% Glycerol
Immunogen PSMG3, 1-122aa. MGSSHHHHHHSSGLVPRGSHMEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
Concentration 0.5mg/mL
For Use With (Application) ELISA,SDS-PAGE
Source Human
689

Novus Biologicals™ Mouse IgG F(ab)2 Isotype Control
SDP

Mouse Isotype Control Antibody