Antibiotics
- (3)
- (1)
- (1)
- (165)
- (26)
- (31)
- (6)
- (18)
- (1)
- (1)
- (36)
- (1)
- (8)
- (5)
- (28)
- (1)
- (2)
- (1)
- (1)
- (4)
- (1)
- (72)
- (10)
- (3)
- (44)
- (2)
- (1)
- (1)
- (2)
- (3)
- (4)
- (5)
- (1)
- (2)
- (138)
- (7)
- (13)
- (4)
- (23)
- (5)
- (1)
- (27)
- (174)
- (6)
- (1)
- (23)
- (22)
- (1)
- (9)
- (1)
- (23)
- (1)
- (19)
- (1)
- (29)
- (1)
- (1)
- (24)
- (1)
- (2)
- (1)
- (144)
- (1)
- (2)
- (1)
- (5)
- (1)
- (2)
- (2)
- (13)
- (3)
- (1)
- (4)
- (5)
- (1)
- (4)
- (2)
- (17)
- (1)
- (4)
- (7)
- (1)
- (3)
- (2)
- (4)
- (1)
- (2)
- (5)
- (1)
- (2)
- (5)
- (6)
- (2)
- (3)
- (1)
- (2)
- (1)
- (9)
- (3)
- (2)
- (2)
- (3)
- (3)
- (12)
- (2)
- (2)
- (2)
- (7)
- (3)
- (2)
- (2)
- (1)
- (2)
- (4)
- (6)
- (2)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (5)
- (2)
- (1)
- (2)
- (2)
- (2)
- (1)
- (4)
- (2)
- (2)
- (5)
- (4)
- (2)
- (2)
- (1)
- (5)
- (7)
- (3)
- (2)
- (3)
- (1)
- (2)
- (2)
- (2)
- (3)
- (3)
- (2)
- (2)
- (3)
- (2)
- (1)
- (3)
- (2)
- (2)
- (3)
- (2)
- (1)
- (2)
- (4)
- (4)
- (2)
- (1)
- (3)
- (2)
- (1)
- (5)
- (9)
- (2)
- (1)
- (3)
- (4)
- (7)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (3)
- (2)
- (1)
- (2)
- (7)
- (6)
- (3)
- (3)
- (2)
- (16)
- (1)
- (2)
- (2)
- (2)
- (2)
- (11)
- (1)
- (4)
- (3)
- (3)
- (2)
- (1)
- (4)
- (1)
- (11)
- (7)
- (2)
- (3)
- (1)
- (1)
- (2)
- (7)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (4)
- (1)
- (1)
- (2)
- (3)
- (2)
- (2)
- (2)
- (3)
- (2)
- (1)
- (2)
- (2)
- (5)
- (1)
- (3)
- (4)
- (5)
- (6)
- (5)
- (4)
- (2)
- (1)
- (2)
- (5)
- (2)
- (4)
- (9)
- (9)
- (7)
- (4)
- (3)
- (1)
- (1)
- (2)
- (2)
- (1)
- (2)
- (2)
- (8)
- (1)
- (8)
- (2)
- (14)
- (3)
- (8)
- (1)
- (14)
- (2)
- (2)
- (3)
- (2)
- (4)
- (7)
- (3)
- (2)
- (3)
- (2)
- (3)
- (2)
- (17)
- (4)
- (1)
- (3)
- (2)
- (6)
- (2)
- (1)
- (1)
- (3)
- (6)
- (3)
- (2)
- (1)
- (1)
- (8)
- (4)
- (3)
- (6)
- (3)
- (5)
- (6)
- (1)
- (7)
- (9)
- (2)
- (1)
- (1)
- (11)
- (186)
- (10)
- (9)
- (4)
- (7)
- (111)
- (10)
- (1)
- (1)
- (507)
- (2)
- (17)
- (52)
- (3)
- (1)
- (3)
- (3)
- (3)
- (7)
- (1)
- (1)
- (9)
- (4)
- (3)
- (13)
- (5)
- (2)
- (17)
- (8)
- (2)
- (4)
- (1)
- (1)
- (1)
- (4)
- (1)
- (1)
- (2)
- (6)
- (5)
- (2)
- (8)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (2)
- (1)
- (2)
- (2)
- (3)
- (2)
- (2)
- (2)
- (2)
- (7)
- (4)
- (1)
- (3)
- (6)
- (5)
- (1)
- (6)
- (2)
- (2)
- (3)
- (2)
- (3)
- (1)
- (1)
- (4)
- (5)
- (3)
- (8)
- (1)
- (2)
- (1)
- (5)
- (3)
- (2)
- (2)
- (1)
- (10)
- (2)
- (2)
- (7)
- (1)
- (2)
- (4)
- (7)
- (2)
- (5)
- (5)
- (2)
- (2)
- (2)
- (1)
- (5)
- (3)
- (2)
- (3)
- (3)
- (1)
- (1)
- (5)
- (4)
- (4)
- (1)
- (3)
- (4)
- (3)
- (2)
- (5)
- (1)
- (3)
- (2)
- (4)
- (3)
- (2)
- (4)
- (2)
- (2)
- (13)
- (3)
- (2)
- (1)
- (1)
- (2)
- (5)
- (3)
- (7)
- (6)
- (2)
- (4)
- (1)
- (2)
- (3)
- (9)
- (2)
- (7)
- (2)
- (2)
- (1)
- (5)
- (9)
- (1)
- (2)
- (4)
- (7)
- (4)
- (7)
- (5)
- (10)
- (2)
- (2)
- (3)
- (10)
- (1)
- (2)
- (4)
- (1)
- (2)
- (3)
- (1)
- (2)
- (5)
- (1)
- (3)
- (11)
- (1)
- (3)
- (2)
- (10)
- (5)
- (1)
- (13)
- (1)
- (2)
- (2)
- (1)
- (1)
- (4)
- (1)
- (3)
- (1)
- (2)
- (3)
- (2)
- (8)
- (2)
- (1)
- (2)
- (1)
- (20)
- (1)
- (4)
- (2)
- (1)
- (4)
- (1)
- (2)
- (2)
- (2)
- (3)
- (9)
- (2)
- (5)
- (3)
- (4)
- (1)
- (13)
- (11)
- (1)
- (3)
- (12)
- (7)
- (2)
- (2)
- (14)
- (3)
- (3)
- (3)
- (3)
- (4)
- (1)
- (5)
- (2)
- (1)
- (16)
- (1)
- (2)
- (2)
- (1)
- (2)
- (7)
- (1)
- (2)
- (17)
- (7)
- (2)
- (8)
- (2)
- (3)
- (3)
- (2)
- (10)
- (5)
- (8)
- (5)
- (3)
- (1)
- (7)
- (2)
- (4)
- (2)
- (12)
- (2)
- (8)
- (5)
- (3)
- (9)
- (3)
- (6)
- (1)
- (4)
- (3)
- (399)
- (15)
- (2)
- (34)
- (19)
- (54)
- (28)
- (76)
Filtered Search Results
Enzo Life Sciences Actinomycin D, (5mg), CAS Number: 50-76-0
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Intercalating transcription inhibitor. An intercalating transcription inhibitor and antineoplastic antibiotic. Inhibits transcription by binding to DNA at dG residues. Induces apoptosis in many cell lines, but suppresses in PC12 cells induced by topoisomrease II inhibitor etopside. Used at 5-10µg/ml in cell culture for haltiong transcription. The product is not sterile. Formula: C62H86N12O16. MW: 1255.5. CAS Number: 50-76-0. Purity: ≥98% (TLC). Appearance: Red-orange crystalline solid. Solubility: Soluble in DMSO (>20mg/ml), 100% ethanol (1mg/ml) or methanol. Use/Stability: Sensitive to strong acids and bases. Store, as supplied, at -20°C for up to 1 year. Store solutions at -20°C for up to 3 months. Long Term Storage: -20°C
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-110079 5mg Medchemexpress, TNP CAS:519178-28-0 Purity:>98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-110079 5mg TNP CAS:519178-28-0 TNP is a cell-permeable inhibitor of IP6K1 and IP3K, with IC50 values of 0.55 µM and 10.2 µM for IP3K, respectively. TNP binds to the ATP-binding sites of both enzymes. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-109590 10mg Medchemexpress, Arachidonic acid CAS:506-32-1 Purity:>98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-109590 10mg Arachidonic acid CAS:506-32-1 Arachidonic acid is an essential fatty acid and a major constituent of biomembranes. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-109139 10mg Medchemexpress, Taminadenant CAS:1337962-47-6 Purity:>98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-109139 10mg Taminadenant CAS:1337962-47-6 Taminadenant is an antagonist of adenosine receptor. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-106441A 5mg Medchemexpress, Rislenemdaz CAS:808732-98-1 Purity:>98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-106441A 5mg Rislenemdaz CAS:808732-98-1 Rislenemdaz (CERC-301) is an orally bioavailable and selective N-methyl-D-aspartate (NMDA) receptor subunit 2B (GluN2B) antagonist with Ki and IC 50 of 8.1 nM and 3.6 nM, respectively. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-109567A 10mg Medchemexpress, Gemcabene (calcium) CAS:209789-08-2 Purity:>98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-109567A 10mg Gemcabene (calcium) CAS:209789-08-2 Gemcabene calcium (PD-72953 calcium), a first-in-class lipid-lowering agent, lowers low-density lipoprotein cholesterol (LDL-C), decreases triglycerides, and raises high-density lipoprotein cholesterol (HDL-C) and lowers pro-inflammatory acute-phase protein, C-reactive protein (CRP), exerting anti-inflammatory activity[3]. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Chem-Impex International, Inc. Chloramphenicol | 56-75-7 | MFCD00078159 | 100G
Chloramphenicol, 56-75-7, MFCD00078159, 100G
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-10852 10mg Medchemexpress, Arterolane CAS:664338-39-0 Purity:>98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-10852 10mg Arterolane CAS:664338-39-0 Arterolane is an antimalarial agent, with IC50 of both 1.1 nM against P. falciparum Ro73 and W2, respectively. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Research Products International Corp Nalidixic Acid Sodium Salt, 5 Grams
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Nalidixic Acid Sodium Salt is a compound of notable importance in microbiology and pharmaceutical research. This sodium salt formulation of nalidixic acid is a valuable tool for investigating bacterial resistance mechanisms and antibiotic development.
In microbiology, Nalidixic Acid Sodium Salt is widely employed to study bacterial susceptibility and resistance patterns. It serves as a selective agent in microbiological culture media, inhibiting the growth of susceptible bacteria. Researchers use it to assess the effectiveness of antibiotics and to understand the molecular mechanisms behind bacterial resistance, contributing to our understanding of microbial biology and antibiotic resistance.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
![Research Products International Corp Nourseothricin Sulfate [NTC] [clonNAT] [Streptothricin Sulfate], 1 Gram](https://assets.fishersci.com/TFS-Assets/CCG/product-images/VN00006095-N51200-1.03.JPG-250.jpg)
Research Products International Corp Nourseothricin Sulfate [NTC] [clonNAT] [Streptothricin Sulfate], 1 Gram
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Nourseothricin Sulfate, also known as Streptothricin, is a natural, broad-spectrum antibiotic derived from Streptomyces species. It is used as a selective agent in molecular biology, genetics, microbiology, and cell culture. It inhibits protein synthesis in bacterial and eukaryotic cells, enabling selection of transformed cells that express the NAT resistance gene. These cells produce Nourseothricin acetyltransferase, which inactivates the antibiotic. Nourseothricin is commonly used in gene expression studies, plasmid maintenance, and to eliminate bacterial or fungal contaminants from cultures, ensuring purity and stability of resistant strains.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Ubpbio Carbenicillin DisodiumSalt, 5G
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Carbenicillin is a semi-synthetic bactericidal antibiotic in the penicillin family. It primarily acts on Gram-negative bacteria. Carbenicillin is more stable than ampicillin and results in fewer satellite colonies on selection plates.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Med Vet International Clindamycin Hcl Capsules, 150mg, 500ct
VET LICENSE NEEDS TO BE PROVIDED IN 3-4 BUSINESS DAYS OR ORDER WILL BE CANCELLED
Clindamycin capsules are a generic version of Cleocin. It is used to treat a wide variety of bacterial infections and should be stored at room temperature away from light and moisture.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
CPC Scientific H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-OH (trifluoroacetate salt) 1MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Peptide found to have anabolic effect on bone formation in rats that can inhibit the rapid decline in bone formation due to denervation.ONE-LETTER SEQUENCE: AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAMOLECULAR FORMULA: C180H287N57O48MOLECULAR WEIGHT:4016.57STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [112955-31-4], RESEARCH AREA: OsteoporosisREFERENCES: L.J. Suva et al., Science, 237, 893 (1987)
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Sigma Aldrich Fine Chemicals Biosciences 10058-F4 >=98% (HPLC), solid | 403811-55-2 | MFCD00758517 | 5MG
10058-F4 >=98% (HPLC), solid | Purity: >=98% (HPLC) | Mol Wt: 249.35 | 403811-55-2 | MFCD00758517 | 5MG
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC HY-10811 10mg Medchemexpress, GNE-493 CAS:1033735-94-2 Purity:>98%
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Medchemexpress, HY-10811 10mg GNE-493 CAS:1033735-94-2 GNE-493 is a potent, selective, and orally available dual pan-PI3-kinase/mTOR inhibitor with IC50s of 3.4 nM, 12 nM, 16 nM, 16 nM and 32 nM for PI3Kα, PI3Kβ, PI3Kδ, PI3Kγ and mTOR. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More