Chicken Whole Blood
Kingfisher Biotech Inc Jamaican Fruit-eating Bat LIF Recombinant Protein
The Jamaican fruit-eating Bat Leukemia Inhibitory Factor yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Jamaican fruit-eating Bat Leukemia Inhibitory Factor applications are for cell culture, ELISA standard, and Western Blot Control. Jamaican fruit-eating Bat Leukemia Inhibitory Factor yeast-derived recombinant protein can be purchased in multiple sizes. Jamaican fruit-eating Bat Leukemia Inhibitory Factor Specifications: (Molecular Weight: 19.9 kDa) (Amino Acid Sequence: TPLPITPVNA TCVTRHPCHS NVMNQIRNQL VQLNSSANAL FILYYTVQGE PFSNNLEKLC SPNVTDFPPF HANGTEKARL VELYRIAAYL GASLGNITRD QKTLSPHAIS LHSKLNATLD VMRGLLSNVL CRLCSKYHVA HVEVAYGPDT SGKDMFQKKK LGCQLLGKYK QVIAVLAQAF (180)) (Gene ID: 119055186). For research use only. Made in the USA
Kingfisher Biotech Inc Human CCL13 Recombinant Protein
The Human CCL13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human CCL13 applications are for cell culture, ELISA standard, and Western Blot Control. Human CCL13 yeast-derived recombinant protein can be purchased in multiple sizes. Human CCL13 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPDALNVPST CCFTFSSKKI SLQRLKSYVI TTSRCPQKAV IFRTKLGKEI CADPKEKWVQ NYMKHLGRKA HTLKT (75)) (Gene ID: 6357). For research use only. Made in the USA
Kingfisher Biotech Inc Guinea Pig CCL21 Recombinant Protein
The Guinea Pig CCL21 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig CCL21 applications are for cell culture, ELISA standard, and Western Blot Control. Guinea Pig CCL21 yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig CCL21 Specifications: (Molecular Weight: 11.5 kDa) (Amino Acid Sequence: SDGGAQDCCL KYSQKKIPYK VVRSYRKQEL SLGCPMPAIL FLPKKRSQPE LCADPKEAWV QQLMKRLDNP PVQGCRKDRG NPKAGKRGKG SKGCKRTEKT QGP (103)) (Gene ID: 100723733). For research use only. Made in the USA
Kingfisher Biotech Inc Hamster CXCL12 Recombinant Protein
The Hamster CXCL12 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Hamster CXCL12 applications are for cell culture, ELISA standard, and Western Blot Control. Hamster CXCL12 yeast-derived recombinant protein can be purchased in multiple sizes. Hamster CXCL12 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: KPVSLSYRCP CRFFESHVSR SNVKHLKILN TPNCALQIVA RLKSNSRQVC IDPKLKWIQE YLEKALNK (68)) (Gene ID: 101838717). For research use only. Made in the USA
Kingfisher Biotech Inc Human CCL8 Recombinant Protein
The Human CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Human CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Human CCL8 Specifications: (Molecular Weight: 8.9 kDa) (Amino Acid Sequence: QPDSVSIPIT CCFNVINRKI PIQRLESYTR ITNIQCPKEA VIFKTKRGKE VCADPKERWV RDSMKHLDQI FQNLKP (76)) (Gene ID: 6355). For research use only. Made in the USA
Kingfisher Biotech Inc Human CXCL1 Recombinant Protein
The Human CXCL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human CXCL1 applications are for cell culture, ELISA standard, and Western Blot Control. Human CXCL1 yeast-derived recombinant protein can be purchased in multiple sizes. Human CXCL1 Specifications: (Molecular Weight: 10.2 kDa) (Amino Acid Sequence: ATELRCQCLQ TLQGIHPKNI QSVNVKSPGP HCAQTEVIAT LKNGRKACLN PASPIVKKII EKMLNSDKSN (70)) (Gene ID: 2919). For research use only. Made in the USA
Kingfisher Biotech Inc Bovine Prolactin Receptor Recombinant Protein
The Bovine Prolactin Receptor yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine Prolactin Receptor applications are for cell culture, ELISA standard, and Western Blot Control. Bovine Prolactin Receptor yeast-derived recombinant protein can be purchased in multiple sizes. Bovine Prolactin Receptor Specifications: (Molecular Weight: 24.8 kDa) (Amino Acid Sequence: QSPPEKPKLV KCRSPGKETF TCWWEPGADG GLPTNYTLTY HKEGETLIHE CPDYKTGGPN SCYFSKKHTS IWKMYVITVN AINQMGISSS DPLYVHVTYI VEPEPPANLT LELKHPEDRK PYLWIKWSPP TMTDVKSGWF IIQYEIRLKP EKATDWETHF TLKQTQLKIF NLYPGQKYLV QIRCKPDHGY WSEWSPESSI QIPNDFPVKD TSM (213)) (Gene ID: 281422). For research use only. Made in the USA
Kingfisher Biotech Inc Swine Prolactin Receptor Recombinant Protein
The Swine Prolactin Receptor yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine Prolactin Receptor applications are for cell culture, ELISA standard, and Western Blot Control. Swine Prolactin Receptor yeast-derived recombinant protein can be purchased in multiple sizes. Swine Prolactin Receptor Specifications: (Molecular Weight: 24.5 kDa) (Amino Acid Sequence: SPPGKPEIFK CRSPEKETFT CWWKPGADGG LPTNYTLTYH KEGETFTHEC PDYKTGGPNS CYFNKKHTSI WTIYIITVNA TNQMGSSSSD PRYVDVTYIV EPDPPVNLTL ELKKPEDQKP YLWIKWLPPT LVDVRSGWLT LQYEIRLQPE KTAEWETHFA GQQTQFKILS LYPGQKYLVQ VRCKPDHGFW SEWSPESSIQ IPNDFSMKDT TM (212)) (Gene ID: 414916). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken Prolactin Recombinant Protein
The Chicken Prolactin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken Prolactin applications are for cell culture, ELISA standard, and Western Blot Control. Chicken Prolactin yeast-derived recombinant protein can be purchased in multiple sizes. Chicken Prolactin Specifications: (Molecular Weight: 22.7 kDa) (Amino Acid Sequence: LPICPIGSVN CQVSLGELFD RAVKLSHYIH YLSSEIFNEF DERYAQGRGF ITKAVNGCHT SSLTTPEDKE QAQQIHHEDL LNLVVGVLRS WNDPLIHLAS EVQRIKEAPD TILWKAVEIE EQNKRLLEGM EKIVGRVHSG DAGNEIYSHW DGLPSLQLAD EDSRLFAFYN LLHCLRRDSH KIDNYLKVLK CRLIHDSN (198)) (Gene ID: 396453). For research use only. Made in the USA
Kingfisher Biotech Inc Rat Prolactin Receptor Recombinant Protein
The Rat Prolactin Receptor yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat Prolactin Receptor applications are for cell culture, ELISA standard, and Western Blot Control. Rat Prolactin Receptor yeast-derived recombinant protein can be purchased in multiple sizes. Rat Prolactin Receptor Specifications: (Molecular Weight: 24.6 kDa) (Amino Acid Sequence: QSPPGKPEIH KCRSPDKETF TCWWNPGTDG GLPTNYSLTY SKEGEKTTYE CPDYKTSGPN SCFFSKQYTS IWKIYIITVN ATNQMGSSSS DPLYVDVTYI VEPEPPRNLT LEVKQLKDKK TYLWVKWSPP TITDVKTGWF TMEYEIRLKP EEAEEWEIHF TGHQTQFKVF DLYPGQKYLV QTRCKPDHGY WSRWSQESSV EMPNDFTLKD (210)) (Gene ID: 24684). For research use only. Made in the USA
Kingfisher Biotech Inc Human IL-36 gamma Recombinant Protein
The Human IL-36 gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human IL-36 gamma applications are for cell culture, ELISA standard, and Western Blot Control. Human IL-36 gamma yeast-derived recombinant protein can be purchased in multiple sizes. Human IL-36 gamma Specifications: (Molecular Weight: 17.0 kDa) (Amino Acid Sequence: SMCKPITGTI NDLNQQVWTL QGQNLVAVPR SDSVTPVTVA VITCKYPEAL EQGRGDPIYL GIQNPEMCLY CEKVGEQPTL QLKEQKIMDL YGQPEPVKPF LFYRAKTGRT STLESVAFPD WFIASSKRDQ PIILTSELGK SYNTAFELNI ND (152)) (Gene ID: 56300). For research use only. Made in the USA
Kingfisher Biotech Inc Feline IL-36RA Recombinant Protein
The Feline IL-36 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-36 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. Feline IL-36 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-36 Receptor Antagonist Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence VLSGALCFRM KDAELKVLYL HDNQLLAGRL HAGNIIQGEE ISVVPNRSLD AKLSPVILGV QGGSQCLSCG TGQEPTLKLE PVNIMELYLG AKESKSFTFY RRDTGLTSSF ESAAYPGWFL CTVPEADQPL RLTQLSEDAS WDSPITDFYF QQCD (154)) (Gene ID: 101097230). For research use only. Made in the USA
Kingfisher Biotech Inc Bovine IL-9 Recombinant Protein
The Bovine IL-9 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-9 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine IL-9 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-9 Specifications: (Molecular Weight: 13.4 kDa) (Amino Acid Sequence: SQGCFTLTGI RNAVYLIDNL QKDTSSKCSC STNATDCLCL PISSGDCSTA CFQEGLSQMS SSTVSTRFHL IVNQLKKIVV TLKSNKCGSF ACEQPCNRTT TGNTLTFLKA LLESFQNDRM RGKA (124)) (Gene ID: 613392). For research use only. Made in the USA
Kingfisher Biotech Inc Swine CCL8 Recombinant Protein
The Swine CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Swine CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL8 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPDSVSIPIT CCFGLVNGKI PFKKLESYTR ITNSQCPQEA VIFKTKADKE VCADPQQKWV QNSMKLLDQK SQTPKP (76)) (Gene ID: 100302703). For research use only. Made in the USA
Kingfisher Biotech Inc Egyptian Rousette Bat M-CSF Recombinant Protein
The Egyptian Rousette Bat M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat M-CSF Specifications: (Molecular Weight: 18.8 kDa) (Amino Acid Sequence: KEESKHCSYMIGDGHLQLLQQLIDSQMETSCPISFEFVDKERLKDPVCYVKKAFFLVQEIMEDTVRFKDNTSNAHAILKLQELSVSLEACFPKDFEEKDKACVGNFSESPLQLLEKIKNFFNETKNLLKKDRNIFSKNCSNTFAQCSSQSHKPERLEPWPHG (162)) (Gene ID: 107516132). For research use only. Made in the USA