Chicken Whole Blood
Kingfisher Biotech Inc Guinea Pig CCL21 Recombinant Protein
The Guinea Pig CCL21 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig CCL21 applications are for cell culture, ELISA standard, and Western Blot Control. Guinea Pig CCL21 yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig CCL21 Specifications: (Molecular Weight: 11.5 kDa) (Amino Acid Sequence: SDGGAQDCCL KYSQKKIPYK VVRSYRKQEL SLGCPMPAIL FLPKKRSQPE LCADPKEAWV QQLMKRLDNP PVQGCRKDRG NPKAGKRGKG SKGCKRTEKT QGP (103)) (Gene ID: 100723733). For research use only. Made in the USA
Kingfisher Biotech Inc Canine CTLA-4 Recombinant Protein
The Canine CTLA-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine CTLA-4 applications are for cell culture, ELISA standard, and Western Blot Control. Canine CTLA-4 yeast-derived recombinant protein can be purchased in multiple sizes. Canine CTLA-4 Specifications: (Molecular Weight: 13.4 kDa) (Amino Acid Sequence: KGMHVAQPAV VLASSRGVAS FVCEYGSSGN AAEVRVTVLR QAGSQMTEVC AATYTVEDEL AFLDDSTCTG TSSGNKVNLT IQGLRAMDTG LYICKVELMY PPPYYVGMGN GTQIYVIDPE PCPDSD (126)) (Gene ID: 403696). For research use only. Made in the USA
Kingfisher Biotech Inc Human CXCL1 Recombinant Protein
The Human CXCL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human CXCL1 applications are for cell culture, ELISA standard, and Western Blot Control. Human CXCL1 yeast-derived recombinant protein can be purchased in multiple sizes. Human CXCL1 Specifications: (Molecular Weight: 10.2 kDa) (Amino Acid Sequence: ATELRCQCLQ TLQGIHPKNI QSVNVKSPGP HCAQTEVIAT LKNGRKACLN PASPIVKKII EKMLNSDKSN (70)) (Gene ID: 2919). For research use only. Made in the USA
Kingfisher Biotech Inc Rabbit IL-2 Biotinylated Recombinant Protein
The Rabbit IL-2 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit IL-2 Biotinylated applications are for cell culture. Rabbit IL-2 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit IL-2 Biotinylated Specifications: (Molecular Weight: 15.1 kDa) (Amino Acid Sequence: APTSSSTKETQEQLDQLLLDLQVLLKGVNDYKNSKLSRMLTFKFYMPKKVTELKHLQCLEEELKPLEEVLNLAQGKNSHGGNTRESISNINVTVLKLKGSETFMCEYDETVTIVEFLNRWITFCQSIISASSS (133)) (Gene ID: 100302458). For research use only. Made in the USA
Kingfisher Biotech Inc Bovine CCL11 Biotinylated Recombinant Protein
The Bovine CCL11 (Eotaxin-1) Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL11 (Eotaxin-1) Biotinylated applications are for cell culture. Bovine CCL11 (Eotaxin-1) Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL11 (Eotaxin-1) Biotinylated Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPASIPTICCFNMSKKKISIQRLQSYRKITSSKCPQKAVIFNTKQNKKICVDPQEKWVQNAMEYLNQKSQTLKS) (Gene ID: 404072). For research use only. Made in the USA
Kingfisher Biotech Inc Bovine IFN gamma Biotinylated Recombinant Protein
The Bovine IFN gamma Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IFN gamma Biotinylated applications are for cell culture. Bovine IFN gamma Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IFN gamma Biotinylated Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: QGQFFREIEN LKEYFNASSP DVAKGGPLFS EILKNWKDES DKKIIQSQIV SFYFKLFENL KDNQVIQRSM DIIKQDMFQK FLNGSSEKLE DFKKLIQIPV DDLQIQRKAI NELIKVMNDL SPKSNLRKRK RSQNLFRGRR AST) (Gene ID: 281237). For research use only. Made in the USA
Kingfisher Biotech Inc Ovine LIF Recombinant Protein
The Ovine LIF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ovine LIF applications are for cell culture, ELISA standard, and Western Blot Control. Ovine LIF yeast-derived recombinant protein can be purchased in multiple sizes. Ovine LIF Specifications: (Molecular Weight: 19.8 kDa) (Amino Acid Sequence: SPLPITPVNA TCATRHPCPS NLMNQIRNQL GQLNSSANSL FILYYTAQGE PFPNNLDKLC SPNVTDFPPF HANGTEKARL VELYRIIAYL GASLGNITRD QKVLNPYAHS LHSKLNATAD VLRGLLSNVL CRLCSKYHVS HVDVTYGPDT SGKDIFQKKK LGCQLLGKYK QVIAVLAQAF (180)) (Gene ID: 101110180). For research use only. Made in the USA
Kingfisher Biotech Inc Human CCL13 Recombinant Protein
The Human CCL13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human CCL13 applications are for cell culture, ELISA standard, and Western Blot Control. Human CCL13 yeast-derived recombinant protein can be purchased in multiple sizes. Human CCL13 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPDALNVPST CCFTFSSKKI SLQRLKSYVI TTSRCPQKAV IFRTKLGKEI CADPKEKWVQ NYMKHLGRKA HTLKT (75)) (Gene ID: 6357). For research use only. Made in the USA
Kingfisher Biotech Inc Jamaican Fruit-eating Bat Eotaxin Recombinant Protein
The Jamaican Fruit-eating Bat Eotaxin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Jamaican Fruit-eating Bat Eotaxin applications are for cell culture, ELISA standard, and Western Blot Control. Jamaican Fruit-eating Bat Eotaxin yeast-derived recombinant protein can be purchased in multiple sizes. Jamaican Fruit-eating Bat Eotaxin Specifications: (Molecular Weight: 8.8 kDa) (Amino Acid Sequence: HRAPSSVIGP TVCCINMANR SISVKRLESY RRLTSSRCPL EAVIFRTKQA KDVCANPKDK WVQRAMKYLD QKSQTPK (77)) (Gene ID: 119065321). For research use only. Made in the USA
Kingfisher Biotech Inc Human CCL8 Recombinant Protein
The Human CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Human CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Human CCL8 Specifications: (Molecular Weight: 8.9 kDa) (Amino Acid Sequence: QPDSVSIPIT CCFNVINRKI PIQRLESYTR ITNIQCPKEA VIFKTKRGKE VCADPKERWV RDSMKHLDQI FQNLKP (76)) (Gene ID: 6355). For research use only. Made in the USA
Kingfisher Biotech Inc Bovine Prolactin Receptor Recombinant Protein
The Bovine Prolactin Receptor yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine Prolactin Receptor applications are for cell culture, ELISA standard, and Western Blot Control. Bovine Prolactin Receptor yeast-derived recombinant protein can be purchased in multiple sizes. Bovine Prolactin Receptor Specifications: (Molecular Weight: 24.8 kDa) (Amino Acid Sequence: QSPPEKPKLV KCRSPGKETF TCWWEPGADG GLPTNYTLTY HKEGETLIHE CPDYKTGGPN SCYFSKKHTS IWKMYVITVN AINQMGISSS DPLYVHVTYI VEPEPPANLT LELKHPEDRK PYLWIKWSPP TMTDVKSGWF IIQYEIRLKP EKATDWETHF TLKQTQLKIF NLYPGQKYLV QIRCKPDHGY WSEWSPESSI QIPNDFPVKD TSM (213)) (Gene ID: 281422). For research use only. Made in the USA
Kingfisher Biotech Inc Bovine IL-16 Biotinylated Recombinant Protein
The Bovine IL-16 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-16 Biotinylated applications are for cell culture. Bovine IL-16 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-16 Biotinylated Specifications: (Molecular Weight: 13.3 kDa) (Amino Acid Sequence: ATTDLNSSTDSSGSASVTSDVSIESAEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTVNRIFKGLASEQSDTVQPGDEIVHLAGTAMQGLTRFEAWNIIKALPDGPVTIVLRRKSLQSKGTPAAGDP (130)) (Gene ID: 506314). For research use only. Made in the USA
Kingfisher Biotech Inc Swine CCL3L1 Biotinylated Recombinant Protein
The Swine CCL3L1 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL3L1 Biotinylated applications are for cell culture. Swine CCL3L1 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL3L1 Biotinylated Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APLGADTPTACCFSYTSRQLPRKFVADYFETSSQCSKPGVIFQTKKGREVCANPEDAWVQEYISDLELNA) (Gene ID: 494459). For research use only. Made in the USA
Kingfisher Biotech Inc Bovine IL-17A Biotinylated Recombinant Protein
The Bovine IL-17A Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-17A Biotinylated applications are for cell culture. Bovine IL-17A Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-17A Biotinylated Specifications: (Molecular Weight: 15.0 kDa) (Amino Acid Sequence: KAGVIIPQSP GCPPTEDKNF PQHVRVNLNI VNRSTNSRRP TDYHKRSTSP WTLHRNEDPE RYPSVIWEAK CSHSGCINAE GKVDHHMNSV TIQQEILVLR RESQHCPHSF RLEKMLVAVG CTCVTPIVRH LA (132)) (Gene ID: 282863). For research use only. Made in the USA
Kingfisher Biotech Inc Equine IL-2 Biotinylated Recombinant Protein
The Equine IL-2 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-2 Biotinylated applications are for cell culture. Equine IL-2 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-2 Biotinylated Specifications: (Molecular Weight: 14.9 kDa) (Amino Acid Sequence: APTSSSKRET QQQLKQLQMD LKLLLEGVNN NKNPKLSKML TFKINMPKKA TELKHLQCLE EELKPLEEML KNFLSKDIKE LMSNINVTVL GLKGSETRFT CEYDDETGTI VEFLNKWITF CQSIFSTMT) (Gene ID: 100034204). For research use only. Made in the USA