Chicken Whole Blood
Kingfisher Biotech Inc Guinea Pig IL-6 Recombinant Protein
The Guinea Pig IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. Guinea Pig IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig IL-6 Specifications: (Molecular Weight: 23.0 kDa) (Amino Acid Sequence: AFPTAQVQHD FTADTTDEMT TAEMTTTMPN KPTTSASQVF QMFMRVYQAV KELKNEMNKH NVEKAILNNL DLPKLKLEDG CFFNGYNWET CQLKITPGLF KFQTYLQSMQ NKLQNESENK KAANIYAGIK SLSLFMKSKI NNTEQMEFLS PTPDATLLEK LETQSQTQML LIAEIVLQRL EEFLQDSLRA IRKADWEGRN (200)) (Gene ID: 106027696). For research use only. Made in the USA
Kingfisher Biotech Inc Bovine IL-9 Recombinant Protein
The Bovine IL-9 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-9 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine IL-9 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-9 Specifications: (Molecular Weight: 13.4 kDa) (Amino Acid Sequence: SQGCFTLTGI RNAVYLIDNL QKDTSSKCSC STNATDCLCL PISSGDCSTA CFQEGLSQMS SSTVSTRFHL IVNQLKKIVV TLKSNKCGSF ACEQPCNRTT TGNTLTFLKA LLESFQNDRM RGKA (124)) (Gene ID: 613392). For research use only. Made in the USA
Kingfisher Biotech Inc Swine CCL8 Recombinant Protein
The Swine CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Swine CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL8 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPDSVSIPIT CCFGLVNGKI PFKKLESYTR ITNSQCPQEA VIFKTKADKE VCADPQQKWV QNSMKLLDQK SQTPKP (76)) (Gene ID: 100302703). For research use only. Made in the USA
Kingfisher Biotech Inc Feline IL-18 Recombinant Protein
The Feline IL-18 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-18 applications are for cell culture, ELISA standard, and Western Blot Control. Feline IL-18 yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-18 Specifications: (Molecular Weight: 18.2 kDa) (Amino Acid Sequence: YFGKLEHKLS ILRNLNDQVL FINQGDQPVF EDMPDSDCTD NAPRTEFIIY MYKDSLTRGL AVTISVNYKT MSTLSCENKI ISFKEMSPPE SINDEGNDII FFQRSVPGHD DKIQFESSLY KGYFLACEKE KDLFKLILKK KDENGDKSIM FTVQNKN (157)) (Gene ID: 493688). For research use only. Made in the USA
Kingfisher Biotech Inc Cynomolgus Monkey CCL8 Recombinant Protein
The Cynomolgus Monkey CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CCL8 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: AQPDSVSIPITCCFNVINRKIPIQRLQSYTRITNTQCPKEAVIFKTKWGKEVCADPKERWVRDSMKHLDQMFQNLKP (77)) (Gene ID: 102137164). For research use only. Made in the USA
Kingfisher Biotech Inc Mink IL-8 Recombinant Protein
The Mink IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mink IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. Mink IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Mink IL-8 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: AVLSRVSSEL RCQCIKTHST PFHPKYIKEL RVIDSGPHCE NSEIIVKLVN GKEVCLDPKE DWVQRIVQIF LKKAEKQAS (79)) (Gene ID: 448792). For research use only. Made in the USA
Kingfisher Biotech Inc Human IL-36RA Recombinant Protein
The Human IL-36 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human IL-36 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. Human IL-36 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Human IL-36 Receptor Antagonist Specifications: (Molecular Weight: 16.8 kDa) (Amino Acid Sequence: MVLSGALCFR MKDSALKVLY LHNNQLLAGG LHAGKVIKGE EISVVPNRWL DASLSPVILG VQGGSQCLSC GVGQEPTLTL EPVNIMELYL GAKESKSFTF YRRDMGLTSS FESAAYPGWF LCTVPEADQP VRLTQLPENG GWNAPITDFY FQQC (154)) (Gene ID: 26525). For research use only. Made in the USA
Kingfisher Biotech Inc Feline CCL8 Recombinant Protein
The Feline CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Feline CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Feline CCL8 Specifications: (Molecular Weight: 8.7 kDa) (Amino Acid Sequence: QPGSVSIPIT CCFSVVKGKI PMQKLESYTR ITNIQCPQEA VIFKTKTSRE ICADPKQKWV QDFMKRLDQK SQTQKP (76)) (Gene ID: 101097189). For research use only. Made in the USA
Kingfisher Biotech Inc Human IL-36 gamma Recombinant Protein
The Human IL-36 gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human IL-36 gamma applications are for cell culture, ELISA standard, and Western Blot Control. Human IL-36 gamma yeast-derived recombinant protein can be purchased in multiple sizes. Human IL-36 gamma Specifications: (Molecular Weight: 17.0 kDa) (Amino Acid Sequence: SMCKPITGTI NDLNQQVWTL QGQNLVAVPR SDSVTPVTVA VITCKYPEAL EQGRGDPIYL GIQNPEMCLY CEKVGEQPTL QLKEQKIMDL YGQPEPVKPF LFYRAKTGRT STLESVAFPD WFIASSKRDQ PIILTSELGK SYNTAFELNI ND (152)) (Gene ID: 56300). For research use only. Made in the USA
Kingfisher Biotech Inc Feline IL-36RA Recombinant Protein
The Feline IL-36 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-36 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. Feline IL-36 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-36 Receptor Antagonist Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence VLSGALCFRM KDAELKVLYL HDNQLLAGRL HAGNIIQGEE ISVVPNRSLD AKLSPVILGV QGGSQCLSCG TGQEPTLKLE PVNIMELYLG AKESKSFTFY RRDTGLTSSF ESAAYPGWFL CTVPEADQPL RLTQLSEDAS WDSPITDFYF QQCD (154)) (Gene ID: 101097230). For research use only. Made in the USA
Kingfisher Biotech Inc Bat FLT3 Ligand Recombinant Protein
The Jamaican fruit-eating Bat FLT3 Ligand yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Jamaican fruit-eating Bat FLT3 Ligand applications are for cell culture, ELISA standard, and Western Blot Control. Jamaican fruit-eating Bat FLT3 Ligand yeast-derived recombinant protein can be purchased in multiple sizes. Jamaican fruit-eating Bat FLT3 Ligand Specifications: (Molecular Weight: 16.0 kDa) (Amino Acid Sequence: RTPDCTFPHS PISSTFADTI RKLSDYLLED YPVTVATNLH DDKLCWAFWR LVLAQRCMER LKTVAGSQMQ QLLEDVNTEI YFVTSCALQD TSEQLVALKP WITRWNFSGC LELRCQPDSS TLLPSRSPKA LEATALPAAQ AP (142)) (Gene ID: 119046007). For research use only. Made in the USA
Kingfisher Biotech Inc Cynomolgus Monkey IL-21 Recombinant Protein
The Cynomolgus Monkey IL-21 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey IL-21 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey IL-21 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey IL-21 Specifications: (Molecular Weight: 16.0 kDa) (Amino Acid Sequence: HKSSSQGQDR HMIRMRQLID IVDQLKNYVN DLDPEFLPAP EDVETNCEWS AISCFQKAQL KSANTGNNER IINLSIKKLK RKSPSTGAER RQKHRLTCPS CDSYEKKPPK EFLERFKSLL QKMIHQHLSS RTHGSEDS (138)) (Gene ID: 102130762). For research use only. Made in the USA
Kingfisher Biotech Inc Rabbit IL-25 Recombinant Protein
The Rabbit IL-25 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit IL-25 applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit IL-25 yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit IL-25 Specifications: (Molecular Weight: 17.4 kDa) (Amino Acid Sequence: LELWKDCSHR STCCTSKGQA LPEEWLQWTP VPVTPPELEL THPQESCRAS EDGPLNSRAI SPWRYELDRD LNRLPQDLYH ARCLCPHCVS LQTGSHMDPL GNSELLYHNQ TVFYRRPCRG ERGLRQGYCW KEDCIEFLWL VFVLDQELWL K (151)) (Gene ID: 100345869). For research use only. Made in the USA
Kingfisher Biotech Inc Cynomolgus Monkey TIM-3 Recombinant Protein
The Cynomolgus Monkey TIM-3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey TIM-3 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey TIM-3 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey TIM-3 Specifications: (Molecular Weight: 19.4 kDa) (Amino Acid Sequence: SEVEYIAEVG QNAYLPCSYT PAPPGNLVPV CWGKGACPVF DCSNVVLRTD NRDVNDRTSG RYWLKGDFHK GDVSLTIENV TLADSGVYCC RIQIPGIMND EKHNVKLVVI KPAKVTPAPT LQRDLTSAFP RMLTTGEHGP AETQTPGSLP DVNLTVSNFF CELQIFTLTN ELRDSGAT (178)) (Gene ID: n/a). For research use only. Made in the USA
Kingfisher Biotech Inc Bovine TIM-3 Recombinant Protein
The Bovine TIM-3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine TIM-3 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine TIM-3 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine TIM-3 Specifications: (Molecular Weight: 18.8 kDa) (Amino Acid Sequence: AYVSQVGQNA DLPCTYSPAT TENLVPVCWG KGPCPVFECY SLVLRTDGRN VTYQTSSRYL LKRDLHKGDV TLTIKNVTLA DSGTYCCRIQ FPGLMNDRKS NLELIIKPAK VTPAWTPWRD ITTAFPRMLT TKGPVSETRT LKTLHDKNQT EISTLATELQ DMGATTRTG (169)) (Gene ID: 768047). For research use only. Made in the USA