Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.

Search Within Results

1 – 15 of 1,891,792 results

Invitrogen™ CDH17 VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA1325)

Alpaca Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Alpaca
Conjugate	Unconjugated
Applications	Flow Cytometry,Western Blot
Form	Liquid
Gene Accession No.	Q12864
Isotype	VHH
Concentration	1.25 mg/mL
Antigen	CDH17 VHH-8His-Cys-tag
Gene Symbols	Cdh17
Regulatory Status	RUO
Purification Method	Metal-chelate chromatography
Gene Alias	BILL-cadherin; Cadherin; cadherin 17; cadherin 17, LI cadherin (liver-intestine); cadherin-16; cadherin-17; CDH16; CDH17; FLJ26931; HPT1; HPT-1; HPT-1 cadherin; HPT-1/LI; human intestinal peptide-associated transporter HPT-1; human peptide transporter 1; intestinal peptide-associated transporter HPT-1; LI cadherin; LI-cadherin; Liver-intestine cadherin; MGC138218; MGC142024; P130
Gene	Cdh17
Product Type	Antibody
Gene ID (Entrez)	1015
Formulation	16.7mM citrate, 0.94mM citric acid with 6.2% sucrose and no preservative; pH 6
Immunogen	Recombinant Human CDH17/Cadherin-17.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	SAA1325

Invitrogen™ beta Actin Loading Control Monoclonal Antibody (BA3R)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat,Rabbit,Chicken
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P29751, P60706, P60709, P60710, P60711
Isotype	IgG2b
Concentration	1 mg/mL
Antigen	beta Actin Loading Control
Gene Symbols	ACTB
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	0610041G09Rik; AA959943; AAT6; ACT; Act4; Act-4; ACT-5; ACTA; acta1; acta1b; ACTA2; Acta-2; ACTA3; actb; actb.L; actb1; actba; ACTC; actc1; Actc-1; actc1b; ACTE; Actg; ACTG1; Actg2; ACTGE; actin; actin alpha 1; actin alpha 1, skeletal muscle; actin alpha 1, skeletal muscle b; actin alpha 2, smooth muscle; actin alpha cardiac; actin alpha cardiac 1; actin alpha cardiac muscle 1; actin alpha cardiac muscle 1b; actin beta; actin gamma 1; actin gamma 2, smooth muscle; actin, alpha 1, skeletal muscle; actin, alpha 1b, skeletal muscle; actin, alpha 2, smooth muscle, aorta; Actin, alpha cardiac muscle 1; Actin, alpha cardiac muscle 1, intermediate form; actin, alpha cardiac muscle 1b; actin, alpha skeletal muscle; Actin, alpha skeletal muscle, intermediate form; actin, alpha, cardiac 1; actin, alpha, cardiac muscle; actin, alpha, cardiac muscle 1; actin, alpha, vascular smooth muscle; actin, aortic smooth muscle; Actin, aortic smooth muscle, intermediate form; actin, beta; actin, beta 1; actin, beta L homeolog; actin, beta, cytoplasmic; actin, cytoplasmic 1; Actin, cytoplasmic 1, N-terminally processed; Actin, cytoplasmic 2; Actin, cytoplasmic 2, N-terminally processed; actin, gamma 1; actin, gamma 2, smooth muscle, enteric; actin, gamma, cytoplasmic 1; actin, gamma-enteric smooth muscle; Actin, gamma-enteric smooth muscle, intermediate form; actin-like protein; Actl; ACTL3; Acts; ACTSA; ACTSG; Actsk-1; Actvs; Actx; AL023024; alpha actin 1; alpha-actin cardiac; alpha-actin-1; Alpha-actin-2; alpha-actin-3; alphac-actin; Alpha-cardiac actin; alphaSMA; alpha-smooth muscle actin; ASD5; ASMA; a-SMA; Bact; Bact; actin; B-actin; bactin1; bactin1 protein; bactzf; B-ACTZF; beta actin; beta cytoskeletal actin; beta-actin; beta-actin FE-3; beta-actin-1; BRWS1; BRWS2; cardiac muscle alpha actin 1; cardiofunk; cell growth-inhibiting gene 46 protein; Cfk; CFTD; CFTD1; CFTDM; CMD1R; CMH11; cytoplasmic 1; cytoplasmic beta-actin; cytoskeletal beta actin; cytoskeletal gamma-actin; cytoskeletal protein; deafness, autosomal dominant 20; deafness, autosomal dominant 26; DFNA20; DFNA26; E430023M04Rik; E51; epididymis luminal protein 176; fa27h01; fb83f06; gamma non-muscle actin; gamma-2-actin; Gamma-actin; gamma-enteric smooth muscle actin; GIG46; HEL-176; hm:zeh0631; I79_002310; I79_013242; I79_019066; LVNC4; MPFD; MYMY5; NEM1; NEM2; NEM3; nemaline myopathy type 3; PS1TP5-binding protein 1; PS1TP5BP1; SHPM; similar to beta actin; skeletal alpha actin; skeletal alpha1 actin; sma; SMalphaA; SMGA; smooth muscle alpha-actin; smooth muscle gamma-actin; vascular smooth muscle alpha-actin; VSCM; wu:fa27h01; wu:fb63d03; wu:fb83f06; wu:fd18f05; XELAEV_18045052mg; zeh0631
Gene	ACTB
Product Type	Antibody
Gene ID (Entrez)	100009272, 11461, 396526, 60, 81822
Formulation	PBS with no preservative; pH 7.2
Immunogen	Beta-actin N-terminal peptide.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	BA3R

Promotions Available

Human/Mouse TREM2 APC-conjugated Antibody, R&D Systems™

Rat Monoclonal Antibody has been used in 5 publications

Pricing & Availability
Specifications

Content And Storage	Protect from light. Do not freeze. 12 months from date of receipt, 2 to 8 degreesC as supplied.
Target Species	Human,Mouse,Transgenic Mouse
Host Species	Rat
Conjugate	APC
Applications	Flow Cytometry,Immunocytochemistry,Neutralization
Form	Purified
Isotype	IgG2b
Gene Accession No.	Q99NH8
Antigen	TREM2
Gene Symbols	TREM2
Regulatory Status	RUO
Purification Method	Protein A or G purified from hybridoma culture supernatant
Dilution	Flow Cytometry 10 uL/10^6 cells
Gene Alias	PLOSL2, TREM-2, Trem2a, Trem2b, Trem2c, TREM-2triggering receptor expressed on myeloid cells 2a, Triggering receptor expressed on monocytes 2, triggering receptor expressed on myeloid cells 2
Gene ID (Entrez)	54209
Formulation	Supplied in a saline solution containing BSA and Sodium Azide. with Sodium Azide
Immunogen	Mouse myeloma cell line NS0-derived recombinant mouse TREM-2 extracellular domain Accession # Q99NH8
Classification	Monoclonal
Primary or Secondary	Primary
Test Specificity	Detects human and mouse TREM-2 in direct ELISAs and Western blots. Stains TREM-2 transfectants but not TREM-1 transfectants.
Clone	237920

Human PDX-1/IPF1 Antibody, R&D Systems™

Goat Polyclonal Antibody has been used in 27 publications

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Human,Mouse,Pig,Rat,Xenograft
Host Species	Goat
Conjugate	Unconjugated
Applications	Dual RNAScope ISH-IHC,Flow Cytometry,Immunocytochemistry,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Mass Cytometry,Simple Western,Western Blot
Isotype	IgG
Gene Accession No.	P52945
Concentration	LYOPH
Antigen	PDX-1/IPF1
Gene Symbols	PDX1
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 1 ug/mL, Simple Western 10 ug/mL, Immunohistochemistry 5-15 ug/mL, Immunocytochemistry 5-15 ug/mL
Gene Alias	Glucose-sensitive factor, IDX1, IDX-1GSF, Insulin promoter factor 1, insulin promoter factor 1, homeodomain transcription factor, Insulin upstream factor 1, IPF1, IPF1pancreas/duodenum homeobox protein 1, Islet/duodenum homeobox-1, MODY4IUF1, pancreatic and duodenal homeobox 1, pancreatic-duodenal homeobox factor 1, PDX-1IPF-1, somatostatin transcription factor 1, Somatostatin-transactivating factor 1, STF-1IUF-1
Gene ID (Entrez)	3651
Immunogen	E. coli-derived recombinant human PDX-1/IPF1 Ala91-Arg283 Accession # P52945
Classification	Polyclonal
Reconstitution	Reconstitute at 0.2 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects human PDX-1/IPF1 in direct ELISAs and Western blots. In direct ELISAs, approximately 45% cross-reactivity with recombinant mouse PDX-1 is observed.

TDP-43/TARDBP Antibody (2E2-D3), Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Target Species	Human,Mouse,Rat,Bacteria,Insect,Monkey,Firefly
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot,ELISA,Immunohistochemistry,Immunocytochemistry,Immunoprecipitation,Immunohistochemistry (Paraffin),Functional Assay,KnockDown
Form	Purified
Isotype	IgG1 κ
Gene Accession No.	Q13148
Research Discipline	Cell Cycle and Replication, Chromatin Research, DNA replication Transcription Translation and Splicing, Epigenetics, Immunology, Mitochondrial Fusion Proteins, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Transcription Factors and Regulators, Virology Bacteria and Parasites
Antigen	TDP-43/TARDBP
Regulatory Status	RUO
Purification Method	IgG purified
Dilution	Western Blot 1:500, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence 1:10-1:500, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Functional, Knockdown Validated
Gene Alias	ALS10TAR DNA-binding protein-43, TAR DNA binding protein, TDP43, TDP-43, TDP-43TAR DNA-binding protein 43
Gene ID (Entrez)	23435
Formulation	In 1x PBS, pH 7.4
Classification	Monoclonal
Immunogen	TARDBP (NP_031401.1, 1 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA
Primary or Secondary	Primary
Clone	2E2-D3

p62/SQSTM1 Antibody (2C11), Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Target Species	Human,Mouse,Rat,Bovine,Hamster,Rabbit
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot,ELISA,Immunohistochemistry,Immunocytochemistry,Immunoprecipitation,Immunohistochemistry (Paraffin),Immunohistochemistry (Frozen)
Form	Purified
Isotype	IgG2a κ
Gene Accession No.	Q13501
Research Discipline	Adaptive Immunity, Cancer, Chromatin Modifiers, Chromatin Research, DNA Methyltransferases, Epigenetics, Innate Immunity, Tumor Suppressors
Antigen	p62/SQSTM1
Regulatory Status	RUO
Purification Method	IgG purified
Dilution	Western Blot 1:100-1:2000, ELISA, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence 10μg/mL, Immunoprecipitation 1:10-1:1000, Immunohistochemistry-Paraffin 1:10-1:500, Immunohistochemistry-Frozen 1:10-1:500
Gene Alias	A170, Autophagy Receptor P62, DMRV, EBI3-associated protein of 60 kDa, EBI3-associated protein p60, EBIAP, FTDALS3, NADGP, ORCA, OSIL, oxidative stress induced like, p60PDB3, p62, p62B, Paget disease of bone 3, PDB3, phosphotyrosine independent ligand for the Lck SH2 domain p62, Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa, sequestosome 1, sequestosome-1, Ubiquitin-binding protein p62, ZIP3
Gene ID (Entrez)	8878
Formulation	In 1x PBS, pH 7.4
Classification	Monoclonal
Immunogen	SQSTM1 (AAH03139.1, 1 a.a. ~ 440 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL
Primary or Secondary	Primary
Clone	2C11

Cadherin-11 Antibody (1A5), Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot,Flow Cytometry,ELISA,Immunohistochemistry,Immunoprecipitation,Functional Assay
Form	Purified
Isotype	IgG
Gene Accession No.	P55287
Research Discipline	Cancer
Antigen	Cadherin-11
Regulatory Status	RUO
Purification Method	IgG purified
Dilution	Western Blot, Flow Cytometry, ELISA, Immunohistochemistry, Immunoprecipitation, Functional
Gene Alias	CAD11OSF-4, cadherin 11, type 2, OB-cadherin (osteoblast), cadherin-11, CDHOB, OB, OB-cadherin, Osteoblast cadherin
Gene ID (Entrez)	1009
Formulation	In 1x PBS, pH 7.4
Classification	Monoclonal
Immunogen	CDH11 (P55287, 54 a.a. ~ 612 a.a) partial recombinant protein with Fc tag at C terminal. MW of the Fc tag alone is 50 KDa. 0
Primary or Secondary	Primary
Clone	1A5

MTAP Antibody (2G4), Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot,ELISA,Immunohistochemistry,Immunocytochemistry,Immunohistochemistry (Paraffin)
Form	Purified
Isotype	IgG1 κ
Gene Accession No.	AAH18625
Antigen	MTAP
Regulatory Status	RUO
Purification Method	IgG purified
Dilution	Western Blot 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin
Gene Alias	5'-methylthioadenosine phosphorylase, c86fus, EC 2.4.2.28, methylthioadenosine phosphorylase, MSAPMeSAdo phosphorylase, MTA phosphorylase, MTAPase, S-methyl-5'-thioadenosine phosphorylase
Gene ID (Entrez)	4507
Formulation	In 1x PBS, pH 7.4
Classification	Monoclonal
Immunogen	MTAP (AAH18625, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS
Primary or Secondary	Primary
Clone	2G4

Promotions Available

Human/Mouse/Rat CD31/PECAM-1 Antibody, R&D Systems™

Goat Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Chicken,Cynomolgus Monkey,Golden Syrian Hamster,Human,Mouse,Pig,Primate,Rabbit,Rat,Rhesus Macaque,Transgenic Mouse,Xenograft
Host Species	Goat
Conjugate	Unconjugated
Applications	Cell Culture,Cell Selection,CyTOF,Flow Cytometry,Functional Assay,Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),In vivo Assay,Simple Western,Western Blot
Isotype	IgG
Gene Accession No.	Q08481
Concentration	LYOPH
Antigen	CD31/PECAM-1
Gene Symbols	PECAM1
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 0.5 ug/mL, Flow Cytometry 0.25 ug/10^6 cells, Immunohistochemistry 3-15 ug/mL, Immunocytochemistry 5-15 ug/mL, CyTOF-ready
Gene Alias	adhesion molecule, CD31, CD31 antigen, CD31/EndoCAM, EndoCAM, FLJ34100, FLJ58394, GPIIA', PECA1, PECAM1, PECAM-1, PECAM-1, CD31/EndoCAM, platelet endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1, platelet/endothelial cell adhesion molecule
Gene ID (Entrez)	5175
Immunogen	Mouse myeloma cell line NS0-derived recombinant mouse CD31/PECAM-1 Glu18-Lys590 Accession # Q08481
Classification	Polyclonal
Reconstitution	Reconstitute at 0.2 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects mouse CD31/PECAM-1 in direct ELISAs and Western blots. In direct ELISAs and Western blots, approximately 10% cross-reactivity with recombinant human CD31 and recombinant porcine CD31 is observed. Detects mouse CD31 and rat CD31 in flow cytometry.

Promotions Available

Normal Rabbit IgG, Negative Control, R&D Systems™

Rabbit Polyclonal Antibody has been used in 64 publications

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Rabbit
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Control
Isotype	IgG
Concentration	LYOPH
Antigen	IgG
Gene Symbols	IGHG1
Purification Method	Protein A or G purified
Dilution	Control
Gene Alias	Immunoglobulin G, ImmunoglobulinG
Gene ID (Entrez)	3500
Immunogen	NA
Classification	Polyclonal
Reconstitution	Dissolve the lyophilized rabbit IgG in sterile PBS, pH 7.4. If 1 mL of PBS is used, the antibody concentration will be 1 mg/mL.
Test Specificity	Serum was obtained from naive (non-immunized) rabbits and purified for use as normal rabbit IgG.

Mouse anti-Human IgG1 Fc Secondary Antibody (2C11cc), Allophycocyanin, Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Antigen	IgG1 Fc
Regulatory Status	RUO
Content And Storage	Store at 4°C in the dark.
Target Species	Human
Host Species	Mouse
Conjugate	APC
Applications	ELISA,Immunodiffusion,Immunohistochemistry,Immunohistochemistry (Frozen)
Form	Purified
Classification	Monoclonal
Immunogen	Hybridoma clone has been derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice immunized with IgG from human serum.
Primary or Secondary	Secondary
Clone	2C11cc

His Tag Horseradish Peroxidase-conjugated Antibody, R&D Systems™

Mouse Monoclonal Antibody has been used in 12 publications

Pricing & Availability
Specifications

Content And Storage	Do not freeze. 6 months from date of receipt, 2°C to 8°C as supplied.
Target Species	Bacteria,E. coli,Liver Fluke,Human,Mouse,Multi-species,Vibrio parahaemolyticus,Yeast
Host Species	Mouse
Conjugate	HRP
Applications	Binding Activity,Bioassay,ELISA Detection (Matched Antibody Pair),ELISA Development,ELISA Development (Detection),Flow Cytometry,Functional Assay,Neutralization,Simple Western,Western Blot
Form	Purified
Isotype	IgG1
Concentration	LYOPH
Antigen	His Tag
Regulatory Status	RUO
Purification Method	Protein A or G purified from hybridoma culture supernatant
Dilution	Western Blot 1:4000 dilution, Simple Western 1:1000 dilution
Gene Alias	6 His epitope tag, 6X His, 6X-His, H, HHHHHH epitope tag, HHHHHH tag, HIS, His tag, polyHistidine, Poly-histidine
Formulation	Supplied as a 0.2 μm filtered solution in Sodium Phosphate and Proclin 300. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with Proclin 300
Immunogen	His-tagged peptide
Classification	Monoclonal
Primary or Secondary	Primary
Test Specificity	Detects proteins containing accessible consecutive histidine regions. The antibody detects His tags at the amino- or carboxyl-terminus.
Clone	AD1.1.10

Neuron-specific beta-III Tubulin Antibody, R&D Systems™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Amphibian,Avian,Axolotl,Chicken,Human,Mouse,Multi-species,Olive Baboon,Pig,Quail,Rat,Rhesus Macaque,Salamander,Transgenic Mouse,Transgenic Rat,Xenograft
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Flow Cytometry (Intracellular Staining),HSI Microscopy,Immunocytochemistry,Immunofluorescence,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Neutralization,Simple Western,Western Blot
Form	Purified
Isotype	IgG2a
Concentration	LYOPH
Antigen	beta-III Tubulin
Gene Symbols	TUBB3
Regulatory Status	RUO
Purification Method	Protein A or G purified from hybridoma culture supernatant
Dilution	Western Blot 0.2 ug/mL, Simple Western 10 ug/mL, Immunohistochemistry 1-25 ug/mL, Intracellular Staining by Flow Cytometry 0.25 ug/10^6 cells, Immunocytochemistry 0.5-25 ug/mL
Gene Alias	Beta3-tubulin, beta-4, betaIII Tubulin, beta-Tubulin III, Class III beta-tubulin, TUBB3, TUBB4 CFEOM3A, Tubulin Beta 3, tubulin beta-3 chain, Tubulin beta-4, Tubulin beta-4 chain, Tubulin beta-III, tubulin, beta 3, TUJ1 antigen, TUJ-1 antigen
Gene ID (Entrez)	10381
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
Immunogen	Rat brain-derived microtubules
Classification	Monoclonal
Reconstitution	Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects mammalian and chicken neuron-specific beta-III tubulin but not other beta-tubulin isotypes in Western blots.
Clone	TuJ-1

AIF-1/Iba1 Antibody, Novus Biologicals™

Goat Polyclonal Antibody has been used in 192 publications

Pricing & Availability
Specifications

Content And Storage	Store at -20C. Avoid freeze-thaw cycles.
Target Species	Canine,Mouse,Equine,Feline,Human,Mouse,Pig,Rat
Host Species	Goat
Conjugate	Unconjugated
Applications	Dual RNAScope ISH-IHC,Gene Knock-Out,Immunocytochemistry,Immunofluorescence,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Free Floating),Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunohistochemistry (Whole-Mount),Immunoprecipitation,Peptide ELISA,Western Blot
Isotype	IgG
Gene Accession No.	P55008
Research Discipline	Autoimmune Diseases, Cancer, Cell Biology, Cell Cycle and Replication, Immunology, Inflammation, Lipid and Metabolism, Microglia Markers, Neuroscience
Concentration	0.5 mg/mL
Antigen	AIF-1/Iba1
Gene Symbols	AIF1
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 0.1 - 1.0 ug/mL, Immunohistochemistry 4 - 6 ug/mL, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 4 - 6 ug/mL, Immunohistochemistry-Frozen, Peptide ELISA Detection Limit 1:128000, Immunohistochemistry Free-Floating, Immunohistochemistry (Whole-Mount), Knockout Validated, Dual RNAscope ISH-IHC
Molecular Weight of Antigen	16.8 kDa
Gene Alias	AIF-1, allograft inflammatory factor 1, G1, IBA1, IbaI, interferon gamma responsive transcript, Ionized calcium-binding adapter molecule 1, IRT1, IRT-1, Protein G1
Gene ID (Entrez)	199
Formulation	Tris saline (20 mM Tris pH 7.3, 150 mM NaCl), 0.5% BSA with 0.02% Sodium Azide
Classification	Polyclonal
Immunogen	This AIF-1/Iba1 Antibody was developed against a peptide with sequence C-TGPPAKKAISELP, from the C Terminus of the protein sequence according to NP_116573.1; NP_001614.3.
Primary or Secondary	Primary
Test Specificity	This AIF-1/Iba1 Antibody is expected to recognize isoform 1 (NP_116573.1) and isoform 3 (NP_001614.3). AIF-1/Iba1 is thought to be involved in negative regulation of growth of vascular smooth muscle cells, which contributes to the anti-inflammatory response to vessel wall trauma.

Promotions Available

Human/Mouse IL-12/IL-35 p35 Antibody, R&D Systems™

Mouse Monoclonal Antibody has been used in 12 publications

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Human,Mouse,Hamadryas Baboon
Host Species	Mouse
Conjugate	Unconjugated
Applications	Bioassay,CyTOF,ELISA Development,Flow Cytometry,Flow Cytometry (Intracellular Staining),Immunoprecipitation,Neutralization,Western Blot
Form	Ascites
Isotype	IgG1
Gene Accession No.	P29459
Concentration	LYOPH
Antigen	IL-12/IL-35 p35
Gene Symbols	IL12A
Regulatory Status	RUO
Purification Method	Protein A or G purified from ascites
Dilution	Western Blot 1 ug/mL, Intracellular Staining by Flow Cytometry 2.5 ug/10^6 cells, CyTOF-ready
Gene ID (Entrez)	3592
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
Immunogen	S. frugiperda insect ovarian cell line Sf 21-derived recombinant human IL-12/IL-35 p35 Arg23-Ser219 Accession # P29459
Classification	Monoclonal
Reconstitution	Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects human IL-12/IL-35 p35 in direct ELISAs and Western blots. Detects the p35 subunit either as part of a p40/p35 heterodimer or as a free subunit after reduction of the heterodimer. This antibody does not recognize IL-12 p40 homodimers but shows strong cross-reactivity with the p35 subunits from porcine and mouse systems.
Clone	27537

Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ beta Actin Loading Control Monoclonal Antibody (BA3R) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Human/Mouse TREM2 APC-conjugated Antibody, R&D Systems™ GSA/VA ContractAvailable on GSA/VA contract for Federal Government customers.Learn More Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Human PDX-1/IPF1 Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Human/Mouse/Rat CD31/PECAM-1 Antibody, R&D Systems™ GSA/VA ContractAvailable on GSA/VA contract for Federal Government customers.Learn More Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

His Tag Horseradish Peroxidase-conjugated Antibody, R&D Systems™ GSA/VA ContractAvailable on GSA/VA contract for Federal Government customers.Learn More Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Neuron-specific beta-III Tubulin Antibody, R&D Systems™ GSA/VA ContractAvailable on GSA/VA contract for Federal Government customers.Learn More Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Human/Mouse IL-12/IL-35 p35 Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ beta Actin Loading Control Monoclonal Antibody (BA3R)

Human/Mouse TREM2 APC-conjugated Antibody, R&D Systems™

Human PDX-1/IPF1 Antibody, R&D Systems™

Human/Mouse/Rat CD31/PECAM-1 Antibody, R&D Systems™

His Tag Horseradish Peroxidase-conjugated Antibody, R&D Systems™

Neuron-specific beta-III Tubulin Antibody, R&D Systems™

Human/Mouse IL-12/IL-35 p35 Antibody, R&D Systems™