Antibodies
Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.
Primary Antibodies
(1,697,476)
Secondary Antibodies
(72,286)
Isotype Controls and Standards
(12,331)
Antibody Panels and Kits
(1,397)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Search Within Results
Keyword Search:
Clear All
1
–
15
of
1,704,227
results
Invitrogen™ CDH17 VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA1325)
Alpaca Recombinant Monoclonal Antibody
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Alpaca |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Western Blot |
| Form | Liquid |
| Gene Accession No. | Q12864 |
| Isotype | VHH |
| Concentration | 1.25 mg/mL |
| Antigen | CDH17 VHH-8His-Cys-tag |
| Gene Symbols | Cdh17 |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | BILL-cadherin; Cadherin; cadherin 17; cadherin 17, LI cadherin (liver-intestine); cadherin-16; cadherin-17; CDH16; CDH17; FLJ26931; HPT1; HPT-1; HPT-1 cadherin; HPT-1/LI; human intestinal peptide-associated transporter HPT-1; human peptide transporter 1; intestinal peptide-associated transporter HPT-1; LI cadherin; LI-cadherin; Liver-intestine cadherin; MGC138218; MGC142024; P130 |
| Gene | Cdh17 |
| Product Type | Antibody |
| Gene ID (Entrez) | 1015 |
| Formulation | 16.7mM citrate, 0.94mM citric acid with 6.2% sucrose and no preservative; pH 6 |
| Immunogen | Recombinant Human CDH17/Cadherin-17. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | SAA1325 |
Human PDX-1/IPF1 Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Goat Polyclonal Antibody has been used in 27 publications
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | Human,Mouse,Pig,Rat,Xenograft |
| Host Species | Goat |
| Conjugate | Unconjugated |
| Applications | Dual RNAScope ISH-IHC,Flow Cytometry,Immunocytochemistry,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Mass Cytometry,Simple Western,Western Blot |
| Isotype | IgG |
| Gene Accession No. | P52945 |
| Concentration | LYOPH |
| Antigen | PDX-1/IPF1 |
| Gene Symbols | PDX1 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Western Blot 1 ug/mL, Simple Western 10 ug/mL, Immunohistochemistry 5-15 ug/mL, Immunocytochemistry 5-15 ug/mL |
| Gene Alias | Glucose-sensitive factor, IDX1, IDX-1GSF, Insulin promoter factor 1, insulin promoter factor 1, homeodomain transcription factor, Insulin upstream factor 1, IPF1, IPF1pancreas/duodenum homeobox protein 1, Islet/duodenum homeobox-1, MODY4IUF1, pancreatic and duodenal homeobox 1, pancreatic-duodenal homeobox factor 1, PDX-1IPF-1, somatostatin transcription factor 1, Somatostatin-transactivating factor 1, STF-1IUF-1 |
| Gene ID (Entrez) | 3651 |
| Immunogen | E. coli-derived recombinant human PDX-1/IPF1 Ala91-Arg283 Accession # P52945 |
| Classification | Polyclonal |
| Reconstitution | Reconstitute at 0.2 mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Test Specificity | Detects human PDX-1/IPF1 in direct ELISAs and Western blots. In direct ELISAs, approximately 45% cross-reactivity with recombinant mouse PDX-1 is observed. |
Promotions Available
Human/Mouse TREM2 APC-conjugated Antibody, R&D Systems™
Human/Mouse TREM2 APC-conjugated Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rat Monoclonal Antibody has been used in 5 publications
| Content And Storage | Protect from light. Do not freeze. 12 months from date of receipt, 2 to 8 degreesC as supplied. |
|---|---|
| Target Species | Human,Mouse,Transgenic Mouse |
| Host Species | Rat |
| Conjugate | APC |
| Applications | Flow Cytometry,Immunocytochemistry,Neutralization |
| Form | Purified |
| Isotype | IgG2b |
| Gene Accession No. | Q99NH8 |
| Antigen | TREM2 |
| Gene Symbols | TREM2 |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified from hybridoma culture supernatant |
| Dilution | Flow Cytometry 10 uL/10^6 cells |
| Gene Alias | PLOSL2, TREM-2, Trem2a, Trem2b, Trem2c, TREM-2triggering receptor expressed on myeloid cells 2a, Triggering receptor expressed on monocytes 2, triggering receptor expressed on myeloid cells 2 |
| Gene ID (Entrez) | 54209 |
| Formulation | Supplied in a saline solution containing BSA and Sodium Azide. with Sodium Azide |
| Immunogen | Mouse myeloma cell line NS0-derived recombinant mouse TREM-2 extracellular domain Accession # Q99NH8 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Test Specificity | Detects human and mouse TREM-2 in direct ELISAs and Western blots. Stains TREM-2 transfectants but not TREM-1 transfectants. |
| Clone | 237920 |
His Tag Horseradish Peroxidase-conjugated Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody has been used in 12 publications
| Content And Storage | Do not freeze. 6 months from date of receipt, 2°C to 8°C as supplied. |
|---|---|
| Target Species | Bacteria,E. coli,Liver Fluke,Human,Mouse,Multi-species,Vibrio parahaemolyticus,Yeast |
| Host Species | Mouse |
| Conjugate | HRP |
| Applications | Binding Activity,Bioassay,ELISA Detection (Matched Antibody Pair),ELISA Development,ELISA Development (Detection),Flow Cytometry,Functional Assay,Neutralization,Simple Western,Western Blot |
| Form | Purified |
| Isotype | IgG1 |
| Concentration | LYOPH |
| Antigen | His Tag |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified from hybridoma culture supernatant |
| Dilution | Western Blot 1:4000 dilution, Simple Western 1:1000 dilution |
| Gene Alias | 6 His epitope tag, 6X His, 6X-His, H, HHHHHH epitope tag, HHHHHH tag, HIS, His tag, polyHistidine, Poly-histidine |
| Formulation | Supplied as a 0.2 μm filtered solution in Sodium Phosphate and Proclin 300. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with Proclin 300 |
| Immunogen | His-tagged peptide |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Test Specificity | Detects proteins containing accessible consecutive histidine regions. The antibody detects His tags at the amino- or carboxyl-terminus. |
| Clone | AD1.1.10 |
Promotions Available
Human/Mouse/Rat beta-Actin Antibody, R&D Systems™
Human/Mouse/Rat beta-Actin Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | Human,Golden Syrian Hamster,Mouse,Rat,Transgenic Mouse |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Bioassay,Immunocytochemistry,Immunohistochemistry,Immunoprecipitation,Simple Western,Western Blot |
| Form | Purified |
| Isotype | IgG1 |
| Gene Accession No. | P60709 |
| Antigen | beta-Actin |
| Gene Symbols | ACTB |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified from hybridoma culture supernatant |
| Dilution | Western Blot 0.01 ug/mL, Simple Western 1 ug/mL, Immunocytochemistry 0.1-25 ug/mL |
| Gene Alias | ACTB, actin, beta, actin, cytoplasmic 1, B-Actin, Beta Actin, beta cytoskeletal actin, betaActin, Beta-actin, BRWS1, I(2)-Actin, PS1TP5-binding protein 1, PS1TP5BP1 |
| Gene ID (Entrez) | 60 |
| Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative |
| Immunogen | Peptide containing a sequence at the N-terminus of human beta-Actin Accession # P60709 |
| Classification | Monoclonal |
| Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Test Specificity | Detects human, mouse, and rat beta-Actin in Western blots. |
| Clone | 937215 |
Promotions Available
CD3 Antibody (SP7), Novus Biologicals™
CD3 Antibody (SP7), Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Monoclonal Antibody
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Canine,Human,Mouse,Pig |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunocytochemistry/Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),KnockDown,Western Blot |
| Form | Supernatant |
| Isotype | IgG |
| Research Discipline | Adaptive Immunity, Apoptosis, Autoimmune Diseases, Diabetes Research, Immunology, Inflammation, Innate Immunity, Signal Transduction, Stem Cells |
| Antigen | CD3 |
| Gene Symbols | CD3 |
| Regulatory Status | RUO |
| Purification Method | Tissue culture supernatant |
| Dilution | Flow Cytometry, Immunohistochemistry 1:25-1:50, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:25-1:50, Immunohistochemistry-Frozen 1:10 - 1:500, KnockDown Validated |
| Molecular Weight of Antigen | 23.1 kDa |
| Gene Alias | CD3 antigen, delta subunit, CD3d antigen, CD3d antigen, delta polypeptide (TiT3 complex), CD3d molecule, delta (CD3-TCR complex), CD3-DELTA, CD3e antigen, CD3e antigen, epsilon polypeptide (TiT3 complex), CD3e molecule, epsilon (CD3-TCR complex), CD3-epsilon, CD3G, CD3g antigen, CD3g antigen, gamma polypeptide (TiT3 complex), CD3g molecule, epsilon (CD3-TCR complex), CD3g molecule, gamma (CD3-TCR complex), CD3-GAMMA, FLJ17620, FLJ17664, FLJ18683, FLJ79544, FLJ94613, MGC138597, T3DOKT3, delta chain, T3E, T-cell antigen receptor complex, epsilon subunit of T3, T-cell receptor T3 delta chain, T-cell surface antigen T3/Leu-4 epsilon chain, T-cell surface glycoprotein CD3 delta chain, T-cell surface glycoprotein CD3 epsilon chain, TCRE |
| Gene ID (Entrez) | 916 |
| Formulation | Tissue culture supernatant with 0.05% Sodium Azide |
| Classification | Monoclonal |
| Immunogen | Synthetic peptide: KAKAKPVTRGAGA, corresponding to amino acids 156-168 of Human CD3 epsilon chain. |
| Primary or Secondary | Primary |
| Test Specificity | The CD3 antigen is present on early thymocytes and mature T cells and is generally regarded as a pan-T cell marker. This antibody will help detect CD3 expression in normal and neoplastic tissues. This antibody reacts with the intracytoplasmic portion of the CD3 antigen expressed by T cells. It stains human T cells in both the cortex and medulla of the thymus and in peripheral lymphoid tissues. This antibody is suitable for staining normal and neoplastic T cells in formalin-fixed, paraffin-embedded tissues. |
| Clone | SP7 |
Promotions Available
Normal Rabbit IgG, Negative Control, R&D Systems™
Normal Rabbit IgG, Negative Control, R&D Systems™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody has been used in 64 publications
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | Rabbit |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Control |
| Isotype | IgG |
| Concentration | LYOPH |
| Antigen | IgG |
| Gene Symbols | IGHG1 |
| Purification Method | Protein A or G purified |
| Dilution | Control |
| Gene Alias | Immunoglobulin G, ImmunoglobulinG |
| Gene ID (Entrez) | 3500 |
| Immunogen | NA |
| Classification | Polyclonal |
| Reconstitution | Dissolve the lyophilized rabbit IgG in sterile PBS, pH 7.4. If 1 mL of PBS is used, the antibody concentration will be 1 mg/mL. |
| Test Specificity | Serum was obtained from naive (non-immunized) rabbits and purified for use as normal rabbit IgG. |
53BP1 Antibody - BSA Free, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at -20 degreesC. |
|---|---|
| Target Species | Avian,Mouse,Bat,Bovine,Canine,Canine,Drosophila melanogaster,Goat,Fish,Goat,Human,Mouse,Naked mole-rat,Pig,Primate,Rabbit,Rat,Reptile |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Chemotaxis,ChIP Assay,FISH,Flow Cytometry,Flow Cytometry (Intracellular Staining),Gene Knock-Out,FISH,Immunoblot,Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,In Situ Hybridization (ISH),In Situ Hybridization (ISH),KnockDown,Proximity Ligation Assay,Western Blot |
| Isotype | IgG |
| Gene Accession No. | Q12888 |
| Research Discipline | Breast Cancer, Cancer, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Tumor Suppressors |
| Concentration | 1 mg/mL |
| Antigen | 53BP1 |
| Gene Symbols | TP53BP1 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Western Blot 1:5000-1:25000, Chromatin Immunoprecipitation reported in scientific literature (PMID 24591601), Flow Cytometry 1.5 ug/ml, Immunohistochemistry reported in scientific literature (PMID 24987917), Immunocytochemistry/Immunofluorescence 1:1000-1:5000, Immunoprecipitation reported in scientific literature (PMID 25645366), Immunohistochemistry-Paraffin 1:1000-1:5000. Use reported in scientific literature (PMID 27653664), Immunohistochemistry-Frozen reported by customer review, Immunoblotting reported in multiple pieces of scientific literature, In-situ Hybridization reported in scientific literature (PMID 34988401; 33122290), Flow (Intracellular), Chromatin Immunoprecipitation (ChIP), Knockout Validated reported in scientific literature (PMID 26601238), KnockDown Validated |
| Molecular Weight of Antigen | 214 kDa |
| Gene Alias | 53BP1, p202, p53-binding protein 1, p53bp1, TDRD30, TP53-Binding Protein 1, tumor protein 53-binding protein, 1, tumor protein p53 binding protein 1, tumor protein p53-binding protein, 1, tumor suppressor p53-binding protein 1 |
| Gene ID (Entrez) | 7158 |
| Formulation | PBS with 0.05% Sodium Azide |
| Classification | Polyclonal |
| Immunogen | The epitope recognized by 53BP1 Antibody maps to a region between residues 350 and 400 of human 53BP1 [NP_005648.1]. |
| Primary or Secondary | Primary |
| Test Specificity | Human, mouse, rat and goat. Human has been tested in WB, IHC-P and ICC/IF, mouse and goat have only been tested in ICC/IF. Primate reactivity reported in scientific literature (PMID: 18389475).Fish reactivity reported in scientific literature (PMID: 25516420). |
Mouse PDGF R alpha Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Goat Polyclonal Antibody has been used in 74 publications
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | African Green Monkey,Cynomolgus Monkey,Guinea Pig,Human,Mouse,Pig,Rat,Transgenic Mouse,Transgenic Rat,Xenograft |
| Host Species | Goat |
| Conjugate | Unconjugated |
| Applications | Bioassay,Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,In vivo Assay,Neutralization,Western Blot |
| Isotype | IgG |
| Gene Accession No. | P26618 |
| Concentration | LYOPH |
| Antigen | PDGFR alpha |
| Gene Symbols | PDGFRA |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Western Blot 1 ug/mL, Immunohistochemistry 5-15 ug/mL, Neutralization 0.2 - 1.6 ug/mL |
| Gene Alias | alpha-type platelet-derived growth factor receptor, CD140 antigen-like family member A, CD140a, CD140a antigen, EC 2.7.10, EC 2.7.10.1, MGC74795, PDGFR alpha, PDGFR2, PDGFRA, PDGFRA/BCR fusion, PDGF-R-alpha, platelet-derived growth factor receptor, alpha polypeptide, rearranged-in-hypereosinophilia-platelet derived growth factor receptor alphafusion protein, RHEPDGFRA |
| Gene ID (Entrez) | 5156 |
| Immunogen | Mouse myeloma cell line NS0-derived recombinant mouse PDGF R alpha Leu25-Glu524 (Asp65Glu, Gly439Ala, Thr440Ala) Accession # P26618 |
| Classification | Polyclonal |
| Reconstitution | Reconstitute at 0.2 mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Test Specificity | Detects mouse PDGF R alpha in direct ELISAs and Western blots. In direct ELISAs, less than 1% cross-reactivity with recombinant human (rh) PDGF R alpha , rhPDGF R beta , and recombinant mouse PDGF R beta is observed. |
Mouse Leptin R Biotinylated Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Goat Polyclonal Antibody has been used in 14 publications
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | Human,Mouse,Transgenic Mouse |
| Host Species | Goat |
| Conjugate | Biotin |
| Applications | Bioassay,Cell Selection,ELISA Detection (Matched Antibody Pair),Flow Cytometry,Immunocytochemistry,Immunohistochemistry,Immunohistochemistry (Frozen),In vivo Assay,Magnetic Cell Separation,Western Blot |
| Isotype | IgG |
| Gene Accession No. | Q3US58 |
| Concentration | LYOPH |
| Antigen | Leptin R |
| Gene Symbols | LEPR |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Western Blot 0.1 ug/mL, Flow Cytometry 0.25 ug/10^6 cells, ELISA Detection (Matched Antibody Pair) 0.1-0.4 ug/mL |
| Gene Alias | B219, CD295, CD295 antigen, DB, DKFZp686B1731, huB219, LEPR, LEP-R, leptin receptor, LeptinR, OB R, OB receptor, OB-R, OBRCD295 |
| Gene ID (Entrez) | 3953 |
| Immunogen | Mouse myeloma cell line NS0-derived recombinant mouse Leptin R Ala20-Gly839 Accession # Q3US58 |
| Classification | Polyclonal |
| Reconstitution | Reconstitute at 0.2 mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Test Specificity | Detects mouse Leptin R in ELISAs and Western blots. |
Human EGFR (Research Grade Cetuximab Biosimilar) PE-conjugated Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Human Monoclonal Antibody
| Content And Storage | Protect from light. Do not freeze. 12 months from date of receipt, 2 to 8 degreesC as supplied. |
|---|---|
| Target Species | Human,Xenograft |
| Host Species | Human |
| Conjugate | R-PE |
| Applications | Flow Cytometry |
| Form | Supernatant |
| Isotype | IgG1 |
| Antigen | EGFR |
| Purification Method | Protein A or G purified from cell culture supernatant |
| Dilution | Flow Cytometry 10 uL/10^6 cells |
| Gene Alias | avian erythroblastic leukemia viral (v-erb-b) oncogene homolog, cell growth inhibiting protein 40, cell proliferation-inducing protein 61, EC 2.7.10, EC 2.7.10.1, EGF R, epidermal growth factor receptor, epidermal growth factor receptor (avian erythroblastic leukemia viral (v-erb-b)oncogene homolog), ErbB, ErbB1, ERBB1PIG61, HER1, HER-1, mENA, Proto-oncogene c-ErbB-1, Receptor tyrosine-protein kinase erbB-1 |
| Gene ID (Entrez) | 1956 |
| Formulation | Supplied in a saline solution containing BSA and Sodium Azide. |
| Immunogen | Human EGF R/ErbB1 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Test Specificity | Detects human EGFR based on Cetuximab therapeutic antibody. This non-therapeutic antibody uses the same variable region sequence as the therapeutic antibody Cetuximab. This product is for research use only. |
| Clone | Hu1 |
Promotions Available
Human VE-Cadherin Antibody, R&D Systems™
Human VE-Cadherin Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Goat Polyclonal Antibody
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | Bovine,Human,Mouse,Zebrafish |
| Host Species | Goat |
| Conjugate | Unconjugated |
| Applications | CyTOF,ELISA Capture (Matched Antibody Pair),Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Dual RNAScope ISH-IHC,Simple Western,Western Blot |
| Isotype | IgG |
| Gene Accession No. | P33151 |
| Concentration | LYOPH |
| Antigen | VE-Cadherin |
| Gene Symbols | CDH5 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Western Blot 0.25 ug/mL, Flow Cytometry 2.5 ug/10^6 cells, Immunocytochemistry 5-15 ug/mL, CyTOF-ready |
| Gene Alias | 7B4, 7B4 antigen, cadherin 5, type 2 (vascular endothelium), cadherin 5, type 2, VE-cadherin (vascular epithelium), cadherin-5, CD144, CD144 antigen, CDH5, endothelial-specific cadherin, FLJ17376, Vascular endothelial cadherin, VE-cadherin, VECadherin |
| Gene ID (Entrez) | 1003 |
| Immunogen | Mouse myeloma cell line NS0-derived recombinant human VE-Cadherin Asp48-Gln593 Accession # P33151 |
| Classification | Polyclonal |
| Reconstitution | Reconstitute at 0.2 mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Test Specificity | Detects human VE-Cadherin in direct ELISAs and Western blots. In direct ELISAs, approximately 10% cross-reactivity with recombinant mouse VE-Cadherin is observed and less than 5% cross-reactivity with recombinant human E-Cadherin is observed. |
Neuron-specific beta-III Tubulin Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | Amphibian,Avian,Axolotl,Chicken,Human,Mouse,Multi-species,Olive Baboon,Pig,Quail,Rat,Rhesus Macaque,Salamander,Transgenic Mouse,Transgenic Rat,Xenograft |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Flow Cytometry (Intracellular Staining),HSI Microscopy,Immunocytochemistry,Immunofluorescence,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Neutralization,Simple Western,Western Blot |
| Form | Purified |
| Isotype | IgG2a |
| Concentration | LYOPH |
| Antigen | beta-III Tubulin |
| Gene Symbols | TUBB3 |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified from hybridoma culture supernatant |
| Dilution | Western Blot 0.2 ug/mL, Simple Western 10 ug/mL, Immunohistochemistry 1-25 ug/mL, Intracellular Staining by Flow Cytometry 0.25 ug/10^6 cells, Immunocytochemistry 0.5-25 ug/mL |
| Gene Alias | Beta3-tubulin, beta-4, betaIII Tubulin, beta-Tubulin III, Class III beta-tubulin, TUBB3, TUBB4 CFEOM3A, Tubulin Beta 3, tubulin beta-3 chain, Tubulin beta-4, Tubulin beta-4 chain, Tubulin beta-III, tubulin, beta 3, TUJ1 antigen, TUJ-1 antigen |
| Gene ID (Entrez) | 10381 |
| Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative |
| Immunogen | Rat brain-derived microtubules |
| Classification | Monoclonal |
| Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Test Specificity | Detects mammalian and chicken neuron-specific beta-III tubulin but not other beta-tubulin isotypes in Western blots. |
| Clone | TuJ-1 |
Human EphA2 Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody has been used in 4 publications
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | Human,Recombinant Protein,Yeast |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | CyTOF,ELISA Capture (Matched Antibody Pair),Flow Cytometry,Gene Knock-Out,Immunocytochemistry,Immunohistochemistry,Western Blot |
| Form | Purified |
| Isotype | IgG2a |
| Gene Accession No. | P29317 |
| Concentration | LYOPH |
| Antigen | EphA2 |
| Gene Symbols | EPHA2 |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified from hybridoma culture supernatant |
| Dilution | Flow Cytometry 0.25 ug/10^6 cells, Immunocytochemistry 8-25 ug/mL, CyTOF-ready, Knockout Validated 5 ug/mL |
| Gene Alias | ARCC2, EC 2.7.10, EC 2.7.10.1, Eck, ECKepithelial cell receptor protein tyrosine kinase, EPH receptor A2, EphA2, ephrin type-A receptor 2, Epithelial cell kinase, Myk2, Sek2, soluble EPHA2 variant 1, Tyrosine-protein kinase receptor ECK |
| Gene ID (Entrez) | 1969 |
| Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative |
| Immunogen | Mouse myeloma cell line NS0-derived recombinant human EphA2 Gln25-Asn534 Accession # P29317 |
| Classification | Monoclonal |
| Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Test Specificity | Detects human EphA2 in direct ELISAs and Western blots. In direct ELISAs, no cross-reactivity with recombinant mouse EphA4, A5, A6, A7, A8, or recombinant rat EphB1 is observed. |
| Clone | 371805 |
TDP-43/TARDBP Antibody (2E2-D3), Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat,Bacteria,Insect,Monkey,Firefly |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,ELISA,Immunohistochemistry,Immunocytochemistry,Immunoprecipitation,Immunohistochemistry (Paraffin),Functional Assay,KnockDown |
| Form | Purified |
| Isotype | IgG1 κ |
| Gene Accession No. | Q13148 |
| Research Discipline | Cell Cycle and Replication, Chromatin Research, DNA replication Transcription Translation and Splicing, Epigenetics, Immunology, Mitochondrial Fusion Proteins, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Transcription Factors and Regulators, Virology Bacteria and Parasites |
| Antigen | TDP-43/TARDBP |
| Regulatory Status | RUO |
| Purification Method | IgG purified |
| Dilution | Western Blot 1:500, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence 1:10-1:500, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Functional, Knockdown Validated |
| Gene Alias | ALS10TAR DNA-binding protein-43, TAR DNA binding protein, TDP43, TDP-43, TDP-43TAR DNA-binding protein 43 |
| Gene ID (Entrez) | 23435 |
| Formulation | In 1x PBS, pH 7.4 |
| Classification | Monoclonal |
| Immunogen | TARDBP (NP_031401.1, 1 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA |
| Primary or Secondary | Primary |
| Clone | 2E2-D3 |