Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.

Search Within Results

1,831 – 1,845 of 1,911,151 results

1,831

Invitrogen™ Influenza A PB1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Virus
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	0.11 mg/mL
Antigen	Influenza A PB1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Influenza PB1
Product Type	Antibody
Formulation	PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the N-terminus region of Influenza A virus PB1 (A/Puerto Rico/8/1934(H1N1)). The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

1,832

Invitrogen™ CD244 Monoclonal Antibody (eBioPP35 (PP35)), Functional Grade, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human
Host Species	Mouse
Conjugate	Functional Grade
Applications	Flow Cytometry,Functional Assay
Form	Liquid
Gene Accession No.	Q9BZW8
Isotype	IgG1
Concentration	1 mg/mL
Antigen	CD244
Gene Symbols	CD244
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	2B4; C9.1; CD244; CD244 long isoform; CD244 molecule; Cd244 molecule, natural killer cell receptor 2B4; CD244 natural killer cell receptor 2B4; CD244 short isoform; F730046O15Rik; h2B4; Ly90; NAIL; natural killer cell receptor 2B4; NK cell activation inducing ligand NAIL; NK cell activation-inducing ligand; NK cell receptor 2B4; NK cell type I receptor protein 2B4; NKR Nmrk; NKR2B4; Nmrk; non MHC restricted killing associated; non-MHC restricted killing associated; Signaling lymphocytic activation molecule 4; SLAM family member 4; SLAMF4; transmembrane NK cell receptor 2B4
Gene	CD244
Product Type	Antibody
Gene ID (Entrez)	51744
Formulation	PBS with no preservative; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	eBioPP35 (PP35)

1,833

Invitrogen™ MERTK Monoclonal Antibody (DS5MMER), Functional Grade, eBioscience™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Mouse
Host Species	Rat
Conjugate	Functional Grade
Applications	Flow Cytometry,Functional Assay,Immunohistochemistry (Frozen),Immunoprecipitation,Western Blot
Form	Liquid
Gene Accession No.	Q60805
Isotype	IgG2a κ
Concentration	1 mg/mL
Antigen	MERTK
Gene Symbols	Mertk
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	c-Eyk; c-mer; c-mer proto-oncogene tyrosine kinase; Eyk; MER; MER proto-oncogene, tyrosine kinase; MER receptor tyrosine kinase; MERTK; MGC133349; nmf12; Nyk; Proto-oncogene c-Mer; proto-oncogene tyrosine-protein kinase MER; rdy; receptor tyrosine kinase MerTK; Receptor tyrosine tinase gene probably the gene for Rdy; retinal dystrophy; RP38; sMER; sMERTK; soluble MER; soluble MERTK; STK kinase; Tyro 12; Tyro12; Tyrosine-protein kinase Mer
Gene	Mertk
Product Type	Antibody
Gene ID (Entrez)	17289
Formulation	PBS with no preservative
Immunogen	FC-tagged full protein expressed in insect cells.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	DS5MMER

1,834

TSLP Monoclonal Antibody (eBio28F12 (28F12)), Functional Grade, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Mouse
Host Species	Rat
Conjugate	Functional Grade
Applications	Functional Assay,Neutralization
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	Q9JIE6
Concentration	1 mg/mL
Antigen	TSLP
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene	TSLP
Product Type	Antibody
Gene ID (Entrez)	53603
Formulation	PBS with no preservative; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	eBio28F12 (28F12)

1,835

Invitrogen™ GPR40 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O14842
Isotype	IgG
Concentration	1 mg/mL
Antigen	GPR40
Gene Symbols	FFAR1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	FFA1R; FFAR; Ffar1; Free fatty acid receptor 1; G protein-coupled receptor 40; G protein-coupled receptor GPR40; GPCR40; GPR40; G-protein coupled receptor 40; HGNC:4498
Gene	FFAR1
Product Type	Antibody
Gene ID (Entrez)	2864
Formulation	PBS with 50% glycerol, 0.5% BSA and 0.02% sodium azide; pH 7.4
Immunogen	Synthesized peptide derived from human GPR40.
Classification	Polyclonal
Primary or Secondary	Primary

1,836

Invitrogen™ SEC23A Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q01405, Q15436
Isotype	IgG
Concentration	1 mg/mL
Antigen	SEC23A
Gene Symbols	Sec23a
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	CLSD; hSec23A; MGC26267; Msec23; protein transport protein Sec23A; Sec23; Sec23 homolog A (S. cerevisiae); Sec23 homolog A, coat complex II component; Sec23 homolog A, COPII coat complex component; Sec23a; SEC23A (S. cerevisiae); Sec23r; SEC23-related protein A
Gene	Sec23a
Product Type	Antibody
Gene ID (Entrez)	10484, 20334
Formulation	0.1M tris glycine with 10% glycerol and 0.01% thimerosal; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human SEC23A. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

1,837

Invitrogen™ Ki-67 Polyclonal Antibody

Chicken Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Chicken
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	E9PVX6, P46013
Isotype	IgY
Concentration	20.0 mg/mL
Antigen	Ki-67
Gene Symbols	Mki67
Regulatory Status	RUO
Purification Method	IgY fraction
Gene Alias	antigen identified by monoclonal antibody Ki 67; antigen identified by monoclonal antibody Ki-67; Antigen identified by monoclonal antibody Ki-67 homolog; Antigen KI-67; Antigen KI-67 homolog; antigen KI-67; proliferation marker protein Ki-67; antigen KI-67-like; cb31; D630048A14Rik; I79_022666; Ki67; Ki-67; KIA; LOW QUALITY PROTEIN: proliferation marker protein Ki-67; marker of proliferation Ki-67; MIB-; MIB-1; Mki67; PPP1R105; Proliferation marker protein Ki-67; proliferation-related Ki-67 antigen; protein phosphatase 1, regulatory subunit 105; RP11-380J17.2; sb:cb31; si:ch211-250b22.7; unnamed protein product; wu:fa11g09; wu:fb57a07; wu:fi14e05
Gene	Mki67
Product Type	Antibody
Gene ID (Entrez)	17345, 291234, 4288
Formulation	PBS with 10mM sodium azide
Immunogen	Recombinant human ki-67 protein expressed in and purified from E. Coli.
Classification	Polyclonal
Primary or Secondary	Primary

1,838

Invitrogen™ CRB1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P82279, Q8VHS2
Isotype	IgG
Concentration	500 μg/mL
Antigen	CRB1
Gene Symbols	CRB1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	CRB1; crumbs 1, cell polarity complex component; crumbs family member 1, photoreceptor morphogenesis associated; Crumbs homolog 1; LCA8; Protein crumbs homolog 1; RP12
Gene	CRB1
Product Type	Antibody
Gene ID (Entrez)	170788, 23418, 304825
Formulation	PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence of human CRB1 (FRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQ).
Classification	Polyclonal
Primary or Secondary	Primary

1,839

Invitrogen™ MCP-1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Maintain refrigerated at 2-8°C for up to 3 months. For long term storage store at -20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Western Blot
Form	Liquid
Gene Accession No.	P10148, P13500, P14844
Isotype	IgG
Concentration	1 mg/mL
Antigen	MCP-1
Gene Symbols	Ccl2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Acidic seminal fluid protein; AI323594; C-C motif chemokine 2; C-C motif chemokine ligand 2; Ccl2; chemokine (C-C motif) ligand 2; GDCF-2; HC11; H-MCP-1; HSMCR30; immediate-early serum-responsive JE protein; immediate-early serum-responsive protein JE; Je; MCAF; Mcp1; MCP-1; MCP1A; MCP-1A; MGC9434; Monocyte chemoattractant protein 1; monocyte chemoattractant protein-1; monocyte chemotactic and activating factor; Monocyte chemotactic protein 1; monocyte chemotactic protein 1A; Monocyte secretory protein JE; monocyte-chemoattractant protein-1 precursor; platelet-derived growth factor-inducible protein JE; RP23-350G1.3; SCYA2; Sigje; small inducible cytokine A2; small inducible cytokine A2 (monocyte chemotactic protein 1, homologous to mouse Sig-je); small inducible cytokine subfamily A (Cys-Cys), member 2; small inducible gene JE; small-inducible cytokine A2; SMC-CF
Gene	Ccl2
Product Type	Antibody
Gene ID (Entrez)	20296, 24770, 6347
Formulation	PBS with 0.02% sodium azide
Immunogen	A 17 amino acid peptide near the carboxy terminus of human CCL2.
Classification	Polyclonal
Primary or Secondary	Primary

1,840

Invitrogen™ Dengue Virus Type 2 Capsid Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Virus
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	0.16 mg/mL
Antigen	Dengue Virus Type 2 Capsid
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Dengue capsid; Dengue Virus
Product Type	Antibody
Formulation	PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Carrier-protein conjugated synthetic peptide encompassing a sequence within the N-terminus region of Dengue virus Capsid protein (Dengue virus 2 (strain 16681 PDK 53)). The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

1,841

Invitrogen™ TUBA1A Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Chicken,Drosophila,Human,Insect,Mouse,Monkey,Protozoa,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P02552, P68369, P68370, Q71U36
Isotype	IgG
Concentration	1.92 mg/mL
Antigen	TUBA1A
Gene Symbols	TUBA1A
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	alpha 1a antibody; alpha 3 antibody; alpha-tubulin; alpha-tubulin 1; Alpha-tubulin 3; alpha-tubulin 3 antibody; Alpha-tubulin isotype M-alpha-1; B-ALPHA-1; B-ALPHA-1 antibody; brain-specific antibody; Detyrosinated tubulin alpha-1A chain; FLJ25113 antibody; FLJ30169; H2 ALPHA; H2ALPHA; H2-ALPHA; hum-a-tub1; hum-a-tub1 antibody; hum-a-tub2; hum-a-tub2 antibody; LIS3; LIS3 antibody; LOC106557476; M40; MGC117247; MGC16435; OK/SW cl.56; OK/SWcl.56; OK/SW-cl.56; Talpha1 alpha-tubulin; TUBA1; Tuba-1; Tuba1a; TUBA1A antibody; TUBA3; TUBA3 antibody; TUBA6; TUBB1; TUBB5; tubulin alpha 1a; tubulin alpha-1 chain; Tubulin alpha-1A chain; tubulin alpha-1A chain antibody; tubulin alpha-3 chain; tubulin alpha-3 chain antibody; Tubulin B-alpha-1; tubulin B-alpha-1 antibody; tubulin, alpha 1; tubulin, alpha 1 (testis specific); tubulin, alpha 1A; tubulin, alpha 6; tubulin, alpha, brain-specific; unnamed protein product
Gene	TUBA1A
Product Type	Antibody
Gene ID (Entrez)	22142, 429035, 64158, 7846
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human alpha Tubulin. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

1,842

CD210 (IL-10R) Monoclonal Antibody (1B1.3a), Functional Grade, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Mouse
Host Species	Rat
Conjugate	Functional Grade
Applications	Functional Assay
Form	Liquid
Isotype	IgG1
Gene Accession No.	Q61727
Concentration	1 mg/mL
Antigen	CD210 (IL-10R)
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene	Il10ra
Product Type	Antibody
Gene ID (Entrez)	16154
Formulation	PBS with no preservative; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	1B1.3a

1,843

Mouse IgG1 kappa Isotype Control (P3.6.2.8.1), Functional Grade, eBioscience™, Invitrogen™

Mouse Isotype Control

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Not Applicable
Host Species	Mouse
Conjugate	Functional Grade
Applications	Control,Flow Cytometry,Functional Assay
Form	Liquid
Isotype	IgG1 κ
Concentration	1 mg/mL
Antigen	Mouse IgG1 kappa
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	IgG1; Igh-4; Ighg1; Immunoglobulin G; Immunoglobulin G1; immunoglobulin heavy constant gamma 1 (G1m marker); ImmunoglobulinG; ImmunoglobulinG1; VH7183
Formulation	PBS with no preservative; pH 7.2
Primary or Secondary	Isotype Control (Primary)
Clone	P3.6.2.8.1

1,844

Invitrogen™ Avian Influenza H5N1 Neuraminidase Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Virus
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Isotype	IgG
Concentration	1 mg/mL
Antigen	Avian Influenza H5N1 Neuraminidase
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Avian H5N1; H5N1; influenza a
Product Type	Antibody
Formulation	PBS with 20% glycerol and 0.01% thimerosal; pH 7
Immunogen	Recombinant protein encompassing a sequence within the C-terminus region of Influenza A virus H5N1 NA (Neuraminidase) (A/Viet Nam/1203/2004(H5N1)). The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

1,845

Invitrogen™ IL-13 Recombinant Rabbit Monoclonal Antibody (F3B1)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Immunocytochemistry
Form	Liquid
Gene Accession No.	P35225
Isotype	IgG λ
Concentration	1 mg/mL
Antigen	IL-13
Gene Symbols	Il13
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	ALRH; ALRH antibody; BHR1; il 13; Il13; Il-13; IL-13; cytokine; ILN; Interleukin; interleukin 13; Interleukin13; interleukin-13; interleukin-13 precursor; L13; MGC116786; MGC116788; MGC116789; NC30; NC30 antibody; P600; P600 antibody; T-cell activation protein P600
Gene	Il13
Product Type	Antibody
Gene ID (Entrez)	3596
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Protein corresponding to human IL-13 [aa32-aa146].
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	F3B1

Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ Influenza A PB1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD244 Monoclonal Antibody (eBioPP35 (PP35)), Functional Grade, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GPR40 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SEC23A Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Ki-67 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CRB1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MCP-1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Dengue Virus Type 2 Capsid Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TUBA1A Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD210 (IL-10R) Monoclonal Antibody (1B1.3a), Functional Grade, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Avian Influenza H5N1 Neuraminidase Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Influenza A PB1 Polyclonal Antibody

Invitrogen™ CD244 Monoclonal Antibody (eBioPP35 (PP35)), Functional Grade, eBioscience™

Invitrogen™ GPR40 Polyclonal Antibody

Invitrogen™ SEC23A Polyclonal Antibody

Invitrogen™ Ki-67 Polyclonal Antibody

Invitrogen™ CRB1 Polyclonal Antibody

Invitrogen™ MCP-1 Polyclonal Antibody

Invitrogen™ Dengue Virus Type 2 Capsid Polyclonal Antibody

Invitrogen™ TUBA1A Polyclonal Antibody

CD210 (IL-10R) Monoclonal Antibody (1B1.3a), Functional Grade, eBioscience™, Invitrogen™

Invitrogen™ Avian Influenza H5N1 Neuraminidase Polyclonal Antibody