Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.

Search Within Results

16 – 30 of 1,893,045 results

Mouse anti-Human IgG1 Fc Secondary Antibody (2C11cc), Allophycocyanin, R&D Systems™

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Antigen	IgG1 Fc
Regulatory Status	RUO
Content And Storage	Store at 4°C in the dark.
Target Species	Human
Host Species	Mouse
Conjugate	APC
Applications	ELISA,Immunodiffusion,Immunohistochemistry,Immunohistochemistry (Frozen)
Form	Purified
Classification	Monoclonal
Immunogen	Hybridoma clone has been derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice immunized with IgG from human serum.
Primary or Secondary	Secondary
Clone	2C11cc

Human/Mouse/Rat SOX2 Antibody, R&D Systems™

Goat Polyclonal Antibody has been used in 119 publications

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Asian Tiger Mosquito,Bovine,Marmoset,Canine,Chicken,Cynomolgus Monkey,Ferret,Fish,Human,Mouse,Chimpanzee,Pig,Quail,Rabbit,Rat,Rhesus Macaque,Transgenic Mouse,Xenograft,Xenopus species,Zebrafish
Host Species	Goat
Conjugate	Unconjugated
Applications	Binding Activity,Bioassay,ChIP Assay,Co-immunoprecipitation (Co-IP),Dot Blot,Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Mass Spectrometry,Dual RNAScope ISH-IHC,Simple Western,Western Blot
Isotype	IgG
Gene Accession No.	P48431
Antigen	SOX2
Gene Symbols	SOX2
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 1 ug/mL, Simple Western 5 ug/mL, Immunohistochemistry 3-25 ug/mL, Chromatin Immunoprecipitation (ChIP) 5 ug/5 x 10^6 cells, Immunocytochemistry 5-15 ug/mL
Gene Alias	ANOP3, MCOPS3, MGC2413, SRY (sex determining region Y)-box 2, SRY-related HMG-box gene 2, transcription factor SOX2, transcription factor SOX-2
Product Type	Antibody
Gene ID (Entrez)	6657
Immunogen	E. coli-derived recombinant human SOX2 Gly135-Met317 Accession # P48431
Classification	Polyclonal
Reconstitution	Reconstitute at 0.2 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects human SOX2 in direct ELISAs and Western blots.

Human/Mouse/Rat beta-Actin Antibody, R&D Systems™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Human,Golden Syrian Hamster,Mouse,Rat,Transgenic Mouse
Host Species	Mouse
Conjugate	Unconjugated
Applications	Bioassay,Immunocytochemistry,Immunohistochemistry,Immunoprecipitation,Simple Western,Western Blot
Form	Purified
Isotype	IgG1
Gene Accession No.	P60709
Antigen	beta-Actin
Gene Symbols	ACTB
Regulatory Status	RUO
Purification Method	Protein A or G purified from hybridoma culture supernatant
Dilution	Western Blot 0.01 ug/mL, Simple Western 1 ug/mL, Immunocytochemistry 0.1-25 ug/mL
Gene Alias	ACTB, actin, beta, actin, cytoplasmic 1, B-Actin, Beta Actin, beta cytoskeletal actin, betaActin, Beta-actin, BRWS1, I(2)-Actin, PS1TP5-binding protein 1, PS1TP5BP1
Gene ID (Entrez)	60
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
Immunogen	Peptide containing a sequence at the N-terminus of human beta-Actin Accession # P60709
Classification	Monoclonal
Reconstitution	Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects human, mouse, and rat beta-Actin in Western blots.
Clone	937215

p62/SQSTM1 Antibody (2533B) - BSA Free, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Gene Knock-Out,Immunocytochemistry/Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin),Simple Western,Western Blot
Form	Purified
Research Discipline	Adaptive Immunity, Cancer, Chromatin Modifiers, Chromatin Research, DNA Methyltransferases, Epigenetics, Innate Immunity, Tumor Suppressors
Concentration	1.0 mg/mL
Antigen	p62/SQSTM1
Regulatory Status	RUO
Purification Method	Protein A or G purified
Dilution	Western Blot 1 μg/ml, Simple Western 20 μg/ml, Immunohistochemistry 8-25 μg/ml, Immunocytochemistry/ Immunofluorescence 8-25 μg/ml, Immunohistochemistry-Paraffin 8-25 μg/ml, Knockout Validated
Gene Alias	A170, Autophagy Receptor P62, DMRV, EBI3-associated protein of 60 kDa, EBI3-associated protein p60, EBIAP, FTDALS3, NADGP, ORCA, OSIL, oxidative stress induced like, p60PDB3, p62, p62B, Paget disease of bone 3, PDB3, phosphotyrosine independent ligand for the Lck SH2 domain p62, Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa, sequestosome 1, sequestosome-1, Ubiquitin-binding protein p62, ZIP3
Product Type	Antibody
Gene ID (Entrez)	8878
Formulation	PBS
Classification	Monoclonal
Immunogen	Partial recombinant human p62/SQSTM1 protein produced in E. coli (amino acids 368-440) [UniProt Q13501]
Primary or Secondary	Primary
Clone	2533B

Human/Mouse IL-12/IL-35 p35 Antibody, R&D Systems™

Mouse Monoclonal Antibody has been used in 12 publications

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Human,Mouse,Hamadryas Baboon
Host Species	Mouse
Conjugate	Unconjugated
Applications	Bioassay,CyTOF,ELISA Development,Flow Cytometry,Flow Cytometry (Intracellular Staining),Immunoprecipitation,Neutralization,Western Blot
Form	Ascites
Isotype	IgG1
Gene Accession No.	P29459
Concentration	LYOPH
Antigen	IL-12/IL-35 p35
Gene Symbols	IL12A
Regulatory Status	RUO
Purification Method	Protein A or G purified from ascites
Dilution	Western Blot 1 ug/mL, Intracellular Staining by Flow Cytometry 2.5 ug/10^6 cells, CyTOF-ready
Product Type	Antibody
Gene ID (Entrez)	3592
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
Immunogen	S. frugiperda insect ovarian cell line Sf 21-derived recombinant human IL-12/IL-35 p35 Arg23-Ser219 Accession # P29459
Classification	Monoclonal
Reconstitution	Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects human IL-12/IL-35 p35 in direct ELISAs and Western blots. Detects the p35 subunit either as part of a p40/p35 heterodimer or as a free subunit after reduction of the heterodimer. This antibody does not recognize IL-12 p40 homodimers but shows strong cross-reactivity with the p35 subunits from porcine and mouse systems.
Clone	27537

Human AMPKβ1 Antibody, R&D Systems™

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70°CC as supplied. 1 month, 2 to 8°CC under sterile conditions after reconstitution. 6 months, -20 to -70°CC under sterile conditions after reconstitution.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry,Simple Western,Western Blot
Form	Purified
Isotype	IgG2b
Gene Accession No.	Q9Y478
Antigen	AMPK beta 1
Regulatory Status	RUO
Purification Method	Protein A or G purified from hybridoma culture supernatant
Dilution	Western Blot 1 μg/mL, Simple Western 10 μg/mL, Immunohistochemistry 0.5-25 μg/mL
Gene Alias	5'-AMP-activated protein kinase beta-1 subunit, AMP-activated protein kinase beta subunit, AMPK, AMPK beta -1 chain, AMPK beta 1,5'-AMP-activated protein kinase subunit beta-1, AMPK subunit beta-1, AMPKb, HAMPKb, MGC17785, PRKAB1, protein kinase, AMP-activated, beta 1 non-catalytic subunit, protein kinase, AMP-activated, noncatalytic, beta-1
Product Type	Antibody
Gene ID (Entrez)	5564
Formulation	Lyophilized from a 0.2μm filtered solution in PBS with Trehalose. See Certificate of Analysis for details. *Small pack size (-SP) is supplied either lyophilized or as a 0.2μm filtered solution in PBS.
Immunogen	E. coli- derived recombinant human AMPKbeta1, Met1-Ile270, Accession # Q9Y478
Classification	Monoclonal
Reconstitution	Reconstitute lyophilized material at 0.2 mg/ml in sterile PBS. For liquid material, refer to CoA for concentration.
Primary or Secondary	Primary
Clone	1092531

FGF-21 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Immunohistochemistry (Paraffin),Simple Western,Western Blot
Form	Purified
Gene Accession No.	Q9NSA1
Research Discipline	Angiogenesis, Cancer
Concentration	0.5 mg/mL
Antigen	FGF-21
Regulatory Status	RUO
Purification Method	Affinity purified
Dilution	Western Blot 0.2-1 μg/mL, Simple Western 1:100, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Alias	FGF-21, fibroblast growth factor 21
Gene ID (Entrez)	26291
Formulation	PBS, 2% Sucrose
Classification	Polyclonal
Immunogen	Synthetic peptides corresponding to FGF21(fibroblast growth factor 21) The peptide sequence was selected from the N terminal of FGF21 (NP_061986). Peptide sequence DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT.
Primary or Secondary	Primary

Mouse Leptin R Biotinylated Antibody, R&D Systems™

Goat Polyclonal Antibody has been used in 14 publications

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Human,Mouse,Transgenic Mouse
Host Species	Goat
Conjugate	Biotin
Applications	Bioassay,Cell Selection,ELISA Detection (Matched Antibody Pair),Flow Cytometry,Immunocytochemistry,Immunohistochemistry,Immunohistochemistry (Frozen),In vivo Assay,Magnetic Cell Separation,Western Blot
Isotype	IgG
Gene Accession No.	Q3US58
Concentration	LYOPH
Antigen	Leptin R
Gene Symbols	LEPR
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 0.1 ug/mL, Flow Cytometry 0.25 ug/10^6 cells, ELISA Detection (Matched Antibody Pair) 0.1-0.4 ug/mL
Gene Alias	B219, CD295, CD295 antigen, DB, DKFZp686B1731, huB219, LEPR, LEP-R, leptin receptor, LeptinR, OB R, OB receptor, OB-R, OBRCD295
Product Type	Antibody
Gene ID (Entrez)	3953
Immunogen	Mouse myeloma cell line NS0-derived recombinant mouse Leptin R Ala20-Gly839 Accession # Q3US58
Classification	Polyclonal
Reconstitution	Reconstitute at 0.2 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects mouse Leptin R in ELISAs and Western blots.

Human EGFR (Research Grade Cetuximab Biosimilar) PE-conjugated Antibody, R&D Systems™

Human Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Protect from light. Do not freeze. 12 months from date of receipt, 2 to 8 degreesC as supplied.
Target Species	Human,Xenograft
Host Species	Human
Conjugate	R-PE
Applications	Flow Cytometry
Form	Supernatant
Isotype	IgG1
Antigen	EGFR
Regulatory Status	RUO
Purification Method	Protein A or G purified from cell culture supernatant
Dilution	Flow Cytometry 10 uL/10^6 cells
Gene Alias	avian erythroblastic leukemia viral (v-erb-b) oncogene homolog, cell growth inhibiting protein 40, cell proliferation-inducing protein 61, EC 2.7.10, EC 2.7.10.1, EGF R, epidermal growth factor receptor, epidermal growth factor receptor (avian erythroblastic leukemia viral (v-erb-b)oncogene homolog), ErbB, ErbB1, ERBB1PIG61, HER1, HER-1, mENA, Proto-oncogene c-ErbB-1, Receptor tyrosine-protein kinase erbB-1
Product Type	Antibody
Gene ID (Entrez)	1956
Formulation	Supplied in a saline solution containing BSA and Sodium Azide.
Immunogen	Human EGF R/ErbB1
Classification	Monoclonal
Primary or Secondary	Primary
Test Specificity	Detects human EGFR based on Cetuximab therapeutic antibody. This non-therapeutic antibody uses the same variable region sequence as the therapeutic antibody Cetuximab. This product is for research use only.
Clone	Hu1

Human VE-Cadherin Antibody, R&D Systems™

Goat Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Bovine,Human,Mouse,Zebrafish
Host Species	Goat
Conjugate	Unconjugated
Applications	CyTOF,ELISA Capture (Matched Antibody Pair),Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Dual RNAScope ISH-IHC,Simple Western,Western Blot
Isotype	IgG
Gene Accession No.	P33151
Concentration	LYOPH
Antigen	VE-Cadherin
Gene Symbols	CDH5
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 0.25 ug/mL, Flow Cytometry 2.5 ug/10^6 cells, Immunocytochemistry 5-15 ug/mL, CyTOF-ready
Gene Alias	7B4, 7B4 antigen, cadherin 5, type 2 (vascular endothelium), cadherin 5, type 2, VE-cadherin (vascular epithelium), cadherin-5, CD144, CD144 antigen, CDH5, endothelial-specific cadherin, FLJ17376, Vascular endothelial cadherin, VE-cadherin, VECadherin
Product Type	Antibody
Gene ID (Entrez)	1003
Immunogen	Mouse myeloma cell line NS0-derived recombinant human VE-Cadherin Asp48-Gln593 Accession # P33151
Classification	Polyclonal
Reconstitution	Reconstitute at 0.2 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects human VE-Cadherin in direct ELISAs and Western blots. In direct ELISAs, approximately 10% cross-reactivity with recombinant mouse VE-Cadherin is observed and less than 5% cross-reactivity with recombinant human E-Cadherin is observed.

Mouse PDGF R alpha Antibody, R&D Systems™

Goat Polyclonal Antibody has been used in 74 publications

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	African Green Monkey,Cynomolgus Monkey,Guinea Pig,Human,Mouse,Pig,Rat,Transgenic Mouse,Transgenic Rat,Xenograft
Host Species	Goat
Conjugate	Unconjugated
Applications	Bioassay,Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,In vivo Assay,Neutralization,Western Blot
Isotype	IgG
Gene Accession No.	P26618
Concentration	LYOPH
Antigen	PDGFR alpha
Gene Symbols	PDGFRA
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 1 ug/mL, Immunohistochemistry 5-15 ug/mL, Neutralization 0.2 - 1.6 ug/mL
Gene Alias	alpha-type platelet-derived growth factor receptor, CD140 antigen-like family member A, CD140a, CD140a antigen, EC 2.7.10, EC 2.7.10.1, MGC74795, PDGFR alpha, PDGFR2, PDGFRA, PDGFRA/BCR fusion, PDGF-R-alpha, platelet-derived growth factor receptor, alpha polypeptide, rearranged-in-hypereosinophilia-platelet derived growth factor receptor alphafusion protein, RHEPDGFRA
Gene ID (Entrez)	5156
Immunogen	Mouse myeloma cell line NS0-derived recombinant mouse PDGF R alpha Leu25-Glu524 (Asp65Glu, Gly439Ala, Thr440Ala) Accession # P26618
Classification	Polyclonal
Reconstitution	Reconstitute at 0.2 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects mouse PDGF R alpha in direct ELISAs and Western blots. In direct ELISAs, less than 1% cross-reactivity with recombinant human (rh) PDGF R alpha , rhPDGF R beta , and recombinant mouse PDGF R beta is observed.

Human EphA2 Antibody, R&D Systems™

Mouse Monoclonal Antibody has been used in 4 publications

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Human,Recombinant Protein,Yeast
Host Species	Mouse
Conjugate	Unconjugated
Applications	CyTOF,ELISA Capture (Matched Antibody Pair),Flow Cytometry,Gene Knock-Out,Immunocytochemistry,Immunohistochemistry,Western Blot
Form	Purified
Isotype	IgG2a
Gene Accession No.	P29317
Concentration	LYOPH
Antigen	EphA2
Gene Symbols	EPHA2
Regulatory Status	RUO
Purification Method	Protein A or G purified from hybridoma culture supernatant
Dilution	Flow Cytometry 0.25 ug/10^6 cells, Immunocytochemistry 8-25 ug/mL, CyTOF-ready, Knockout Validated 5 ug/mL
Gene Alias	ARCC2, EC 2.7.10, EC 2.7.10.1, Eck, ECKepithelial cell receptor protein tyrosine kinase, EPH receptor A2, EphA2, ephrin type-A receptor 2, Epithelial cell kinase, Myk2, Sek2, soluble EPHA2 variant 1, Tyrosine-protein kinase receptor ECK
Gene ID (Entrez)	1969
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
Immunogen	Mouse myeloma cell line NS0-derived recombinant human EphA2 Gln25-Asn534 Accession # P29317
Classification	Monoclonal
Reconstitution	Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects human EphA2 in direct ELISAs and Western blots. In direct ELISAs, no cross-reactivity with recombinant mouse EphA4, A5, A6, A7, A8, or recombinant rat EphB1 is observed.
Clone	371805

TDP-43/TARDBP Antibody (2E2-D3), Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Target Species	Human,Mouse,Rat,Bacteria,Insect,Monkey,Firefly
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot,ELISA,Immunohistochemistry,Immunocytochemistry,Immunoprecipitation,Immunohistochemistry (Paraffin),Functional Assay,KnockDown
Form	Purified
Isotype	IgG1 κ
Gene Accession No.	Q13148
Research Discipline	Cell Cycle and Replication, Chromatin Research, DNA replication Transcription Translation and Splicing, Epigenetics, Immunology, Mitochondrial Fusion Proteins, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Transcription Factors and Regulators, Virology Bacteria and Parasites
Antigen	TDP-43/TARDBP
Regulatory Status	RUO
Purification Method	IgG purified
Dilution	Western Blot 1:500, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence 1:10-1:500, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Functional, Knockdown Validated
Gene Alias	ALS10TAR DNA-binding protein-43, TAR DNA binding protein, TDP43, TDP-43, TDP-43TAR DNA-binding protein 43
Gene ID (Entrez)	23435
Formulation	In 1x PBS, pH 7.4
Classification	Monoclonal
Immunogen	TARDBP (NP_031401.1, 1 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA
Primary or Secondary	Primary
Clone	2E2-D3

Invitrogen™ Donkey anti-Mouse IgG (H+L) Highly Cross-Adsorbed Secondary Antibody, Alexa Fluor™ 488

Donkey Polyclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Mouse
Host Species	Donkey
Conjugate	Alexa Fluor 488
Applications	Immunocytochemistry,Immunohistochemistry
Form	Liquid
Isotype	IgG
Concentration	2 mg/mL
Antigen	Mouse IgG (H+L) Highly Cross-Adsorbed
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Product Type	Secondary Antibody
Formulation	PBS with 5mM sodium azide; pH 7.5
Immunogen	Gamma Immunoglobins Heavy and Light chains.
Classification	Polyclonal
Primary or Secondary	Secondary

Invitrogen™ Donkey anti-Rabbit IgG (H+L) Highly Cross-Adsorbed Secondary Antibody, Alexa Fluor™ 488

Donkey Polyclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Rabbit
Host Species	Donkey
Conjugate	Alexa Fluor 488
Applications	Flow Cytometry,Immunocytochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin)
Form	Liquid
Isotype	IgG
Concentration	2 mg/mL
Antigen	Rabbit IgG (H+L) Highly Cross-Adsorbed
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Product Type	Secondary Antibody
Formulation	PBS with 5mM sodium azide; pH 7.5
Immunogen	Gamma Immunoglobins Heavy and Light chains.
Classification	Polyclonal
Primary or Secondary	Secondary

Antibodies

Filtered Search Results

Narrow Results

Human/Mouse/Rat SOX2 Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Human/Mouse/Rat beta-Actin Antibody, R&D Systems™ GSA/VA ContractAvailable on GSA/VA contract for Federal Government customers.Learn More Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Human/Mouse IL-12/IL-35 p35 Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Mouse Leptin R Biotinylated Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Human EGFR (Research Grade Cetuximab Biosimilar) PE-conjugated Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Human VE-Cadherin Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Mouse PDGF R alpha Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Human EphA2 Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More