accessibility menu, dialog, popup

UserName
Viewing profile as user:

Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.
Primary Antibodies (1,654,061)
Secondary Antibodies (70,079)
Isotype Controls and Standards (8,525)
Antibody Panels and Kits (1,385)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (2)
  • (972)
  • (191,973)

brands

  • (1)
  • (1)
  • (1)
  • (19,027)
  • (313)
  • (6)
  • (1)
  • (234)
  • (53)
  • (75)
  • (2)
  • (2)
  • (981)
  • (68,368)
  • (8)
  • (60,683)
  • (4)
  • (1)
  • (119)
  • (1)
  • (1,318)
  • (619)
  • (2)
  • (1)
  • (11)
  • (3)
  • (1)
  • (53)
  • (1)
  • (10)
  • (1)
  • (9)
  • (4)
  • (67)
  • (1)
  • (1)
  • (2)
  • (6)
  • (7)
  • (15)
  • (6)
  • (3)
  • (25,914)
  • (500)
  • (19)
  • (3)
  • (1)
  • (9)
  • (3)
  • (2)
  • (1)
  • (4)
  • (212)
  • (58)
  • (1)
  • (6)
  • (1)
  • (132)
  • (5)
  • (31)
  • (1)
  • (11)
  • (2)
  • (1)
  • (13)
  • (4)
  • (31)
  • (1)
  • (21)
  • (3)
  • (14,226)
  • (5)
  • (32,236)
  • (118)
  • (29)
  • (1)
  • (1)
  • (8)
  • (546)
  • (3)
  • (4)
  • (12,581)
  • (1)
  • (1)
  • (3)
  • (1)
  • (74)
  • (3,494)
  • (2)
  • (143)
  • (9)
  • (443)
  • (105)
  • (1)
  • (28,317)
  • (1)
  • (4,236)
  • (1)
  • (1)
  • (1)
  • (17,371)
  • (1)
  • (371)
  • (31,366)
  • (1)
  • (286)
  • (3)
  • (2)
  • (68)
  • (1)
  • (1)
  • (2)
  • (2)
  • (1)
  • (6)
  • (1)
  • (1)
  • (3)
  • (78)
  • (1)
  • (11)
  • (474)
  • (4)
  • (21,286)
  • (41)
  • (4)
  • (2)
  • (10)
  • (65)
  • (11,066)
  • (1)
  • (1)
  • (1)
  • (7)
  • (2)
  • (9)
  • (8)
  • (2)
  • (22)
  • (3)
  • (4)
  • (357)
  • (1)
  • (1)
  • (1)
  • (2)
  • (18)
  • (24)
  • (2)
  • (39)
  • (9)
  • (51)
  • (1)
  • (2)
  • (1)
  • (4)
  • (1)
  • (91)
  • (521)
  • (115)
  • (14)
  • (52)
  • (13)
  • (13)
  • (1,413)
  • (30)
  • (12)
  • (61)
  • (2)
  • (21)
  • (10)
  • (3)
  • (29)
  • (2)
  • (1)
  • (2)
  • (8)
  • (2)
  • (215)
  • (2)
  • (99)
  • (1)
  • (177)
  • (7)
  • (326)
  • (1)
  • (18)
  • (1)
  • (114)
  • (2,231)
  • (124)
  • (2,515)
  • (1)
  • (57)
  • (13)
  • (3)
  • (1)
  • (990)
  • (1)
  • (2)
  • (1)
  • (1)
  • (2)
  • (9)
  • (129)
  • (1)
  • (1)
  • (5)
  • (3)
  • (3)
  • (1)
  • (1)
  • (1)
  • (9)
  • (9)
  • (1)
  • (1)
  • (243)
  • (1)
  • (2)
  • (2,050)
  • (3)
  • (2)
  • (1)
  • (1)
  • (4)
  • (2)
  • (3)
  • (1)
  • (1)
  • (21)
  • (5)
  • (17)
  • (2)
  • (29)
  • (17)
  • (3)
  • (1)
  • (1)
  • (17)
  • (1)
  • (2)
  • (1)
  • (3)
  • (317)
  • (687)
  • (1)
  • (41)
  • (3)
  • (1)
  • (59)
  • (6)
  • (4)
  • (1)
  • (1)
  • (7)
  • (1)
  • (2)
  • (16,231)
  • (23,987)
  • (78)
  • (1)
  • (3,095)
  • (1)
  • (1)
  • (5)
  • (6)
  • (1)
  • (2)
  • (128)
  • (1)
  • (3)
  • (5)
  • (88)
  • (1)
  • (1)
  • (5)
  • (209)
  • (1,772)
  • (5)
  • (14)
  • (1)
  • (1)
  • (1)
  • (17)
  • (9)
  • (2)
  • (240)
  • (113)
  • (1)
  • (52)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (2)
  • (112)
  • (10,550)
  • (1)
  • (5)
  • (207)
  • (1)
  • (8)
  • (1)
  • (8,919)
  • (1)
  • (2)
  • (6)
  • (25)
  • (3)
  • (152)
  • (10)
  • (2)
  • (3)
  • (4)
  • (11)
  • (8)
  • (8)
  • (3)
  • (6)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (1)
  • (956,131)
  • (2)
  • (13)
  • (1)
  • (2)
  • (30,512)
  • (33)
  • (1)
  • (4)
  • (607)
  • (326)
  • (245)
  • (1)
  • (1)
  • (17)
  • (1)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (3)
  • (1)
  • (2)
  • (1)
  • (35,648)
  • (1)
  • (1)
  • (34)
  • (2)
  • (25)
  • (13,255)
  • (3)
  • (1)
  • (1)
  • (3)
  • (1)
  • (1)
  • (2)
  • (7)
  • (59)
  • (1)
  • (15)
  • (103,837)
  • (1)
  • (6)
  • (190)
  • (4)
  • (2)
  • (1)
  • (41)
  • (921)
  • (1)
  • (1)
  • (1)
  • (19)
  • (2,609)
  • (2)
  • (1)
  • (4)
  • (4)
  • (2)
  • (3)
  • (5)
  • (925)
  • (447)
  • (1)
  • (9)
  • (3)
  • (4)
  • (1)
  • (7)
  • (1,703)
  • (371)
  • (1)
  • (1)
  • (1)
  • (907)
  • (129)
  • (12,488)
  • (1)
  • (1)
  • (2)
  • (3,209)
  • (4)
  • (7)
  • (1)
  • (2)
  • (2)
  • (1)
  • (9)
  • (13)
  • (1)
  • (10)
  • (1)
  • (8)
  • (4)
  • (1)
  • (43)
  • (1)
  • (1)
  • (1)
  • (2)
  • (6)
  • (1)
  • (2)
  • (115,196)
  • (9)
  • (1)
  • (62)
  • (3)
  • (1)
  • (11)
  • (1)
  • (1)
  • (2)
  • (4)
  • (2)
  • (7)
  • (3)
  • (3)
  • (10)
  • (8)
  • (1)
  • (36)
  • (2)
  • (34)
  • (563)
  • (1)
  • (3)
  • (1)
  • (2)
  • (1)
  • (1)
  • (10)
  • (11)
  • (3)
  • (1)
  • (1)
  • (2)
  • (40)
  • (7)
  • (1)
  • (19)
  • (917)
  • (2)
  • (4)

special interests

  • (178)
  • (15,242)
  • (163,229)
  • (31)
  • (1,104,804)

Quantity

  • (1)
  • (7)
  • (2)
  • (3,051)
  • (902)
  • (1,758)
  • (4,356)
Show all

Host Species

  • (567)
  • (2,656)
  • (38)
  • (38)
  • (26)
  • (1,858)
  • (726)
Show all

Conjugate

  • (4)
  • (29,233)
  • (9)
  • (1)
  • (44)
  • (2,858)
  • (83)
Show all

Applications

  • (2)
  • (20)
  • (23)
  • (128)
  • (798)
  • (476)
  • (93)
Show all

Target Species

  • (22)
  • (32)
  • (136)
  • (29)
  • (6)
  • (1,451)
  • (130)
Show all

Classification

  • (86)
  • (139)
  • (702,557)
  • (3,641)
  • (11)
  • (687,432)
  • (30,076)
Show all

Isotype

  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (6)
Show all

Regulatory Status

  • (383)
  • (961)
  • (1,343,919)

Form

  • (2,702)
  • (2,120)
  • (1,655)
  • (20)
  • (10)
  • (1)
  • (21)
Show all

Molecular Weight (g/mol)

  • (1)
  • (3)
  • (1)
  • (2)
  • (1)
  • (7)
  • (2)
Show all

Search Within Results
Keyword Search:
16 – 30 of 1,655,860 results
16

BD Biosciences RB705 Mouse Anti-TCF7 (TCF1), BD Horizon™

Mouse Monoclonal Antibody

Content And Storage Store undiluted at 4°C and protected from prolonged exposure to light. Do not freeze.
Target Species Mouse,Human
Host Species Mouse
Conjugate RB705
Applications Flow Cytometry
Form Liquid
Isotype IgG1 κ
Concentration 0.2 mg/mL
Antigen TCF7 (TCF1)
Regulatory Status RUO
Purification Method Affinity Chromatography
Gene Alias TCF-1; TCF-7; Tcf1; Tcf7; transcription factor 7
Gene ID (Entrez) 6932, 21414
Formulation Aqueous buffered solution containing ≤0.09% sodium azide.
Immunogen Mouse TCF-7 Recombinant Protein
Classification Monoclonal
Clone S33-966
18

p62/SQSTM1 Antibody (2533B) - BSA Free, Novus Biologicals™
SDP

Rabbit Monoclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Simple Western,Immunohistochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Form Purified
Research Discipline Adaptive Immunity, Cancer, Chromatin Modifiers, Chromatin Research, DNA Methyltransferases, Epigenetics, Innate Immunity, Tumor Suppressors
Concentration 1.0 mg/mL
Antigen p62/SQSTM1
Regulatory Status RUO
Purification Method Protein A or G purified
Dilution Western Blot 1 μg/ml, Simple Western 20 μg/ml, Immunohistochemistry 8-25 μg/ml, Immunocytochemistry/ Immunofluorescence 8-25 μg/ml, Immunohistochemistry-Paraffin 8-25 μg/ml, Knockout Validated
Gene Alias A170, Autophagy Receptor P62, DMRV, EBI3-associated protein of 60 kDa, EBI3-associated protein p60, EBIAP, FTDALS3, NADGP, ORCA, OSIL, oxidative stress induced like, p60PDB3, p62, p62B, Paget disease of bone 3, PDB3, phosphotyrosine independent ligand for the Lck SH2 domain p62, Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa, sequestosome 1, sequestosome-1, Ubiquitin-binding protein p62, ZIP3
Gene ID (Entrez) 8878
Formulation PBS
Immunogen Partial recombinant human p62/SQSTM1 protein produced in E. coli (amino acids 368-440) [UniProt Q13501]
Classification Monoclonal
Primary or Secondary Primary
Clone 2533B
19
Promotions Available

Human/Mouse IL-12/IL-35 p35 Antibody, R&D Systems™
GREENER_CHOICE

Mouse Monoclonal Antibody has been used in 12 publications

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species Human,Mouse
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot,Flow Cytometry,CyTOF
Isotype IgG1
Gene Accession No. P29459
Concentration LYOPH
Antigen IL-12/IL-35 p35
Gene Symbols IL12A
Regulatory Status RUO
Purification Method Protein A or G purified from ascites
Dilution Western Blot 1 ug/mL, Intracellular Staining by Flow Cytometry 2.5 ug/10^6 cells, CyTOF-ready
Gene ID (Entrez) 3592
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
Immunogen S. frugiperda insect ovarian cell line Sf 21-derived recombinant human IL-12/IL-35 p35 Arg23-Ser219 Accession # P29459
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Test Specificity Detects human IL-12/IL-35 p35 in direct ELISAs and Western blots. Detects the p35 subunit either as part of a p40/p35 heterodimer or as a free subunit after reduction of the heterodimer. This antibody does not recognize IL-12 p40 homodimers but shows strong cross-reactivity with the p35 subunits from porcine and mouse systems.
Clone 27537
21

Human AMPKβ1 Antibody, Novus Biologicals™

Mouse Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70°CC as supplied. 1 month, 2 to 8°CC under sterile conditions after reconstitution. 6 months, -20 to -70°CC under sterile conditions after reconstitution.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry,Simple Western
Form Purified
Isotype IgG2b
Gene Accession No. Q9Y478
Antigen AMPK beta 1
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution Western Blot 1 μg/mL, Simple Western 10 μg/mL, Immunohistochemistry 0.5-25 μg/mL
Gene Alias 5'-AMP-activated protein kinase beta-1 subunit, AMP-activated protein kinase beta subunit, AMPK, AMPK beta -1 chain, AMPK beta 1,5'-AMP-activated protein kinase subunit beta-1, AMPK subunit beta-1, AMPKb, HAMPKb, MGC17785, PRKAB1, protein kinase, AMP-activated, beta 1 non-catalytic subunit, protein kinase, AMP-activated, noncatalytic, beta-1
Gene ID (Entrez) 5564
Formulation Lyophilized from a 0.2μm filtered solution in PBS with Trehalose. See Certificate of Analysis for details. *Small pack size (-SP) is supplied either lyophilized or as a 0.2μm filtered solution in PBS.
Immunogen E. coli- derived recombinant human AMPKbeta1, Met1-Ile270, Accession # Q9Y478
Classification Monoclonal
Reconstitution Reconstitute lyophilized material at 0.2 mg/ml in sterile PBS. For liquid material, refer to CoA for concentration.
Primary or Secondary Primary
Clone 1092531
22

FGF-21 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Simple Western,Immunohistochemistry,Immunohistochemistry (Paraffin)
Form Purified
Gene Accession No. Q9NSA1
Research Discipline Angiogenesis, Cancer
Concentration 0.5 mg/mL
Antigen FGF-21
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 0.2-1 μg/mL, Simple Western 1:100, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Alias FGF-21, fibroblast growth factor 21
Gene ID (Entrez) 26291
Formulation PBS, 2% Sucrose
Classification Polyclonal
Immunogen Synthetic peptides corresponding to FGF21(fibroblast growth factor 21) The peptide sequence was selected from the N terminal of FGF21 (NP_061986). Peptide sequence DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT.
Primary or Secondary Primary
23

NK-1.1 Mouse anti-Mouse, PerCP-Cy5.5, Clone: PK136, BD

Mouse Monoclonal Antibody

Content And Storage Store undiluted at 4°C and protected from prolonged exposure to light. Do not freeze.
Description Klrb1b, CD161b, Nkrp1b; Klrb1c, CD161c, NK1.1, Nkrp1c
Target Species Mouse
Host Species Mouse
Conjugate PerCP-Cyanine5.5
Applications Flow Cytometry
Isotype IgG2a κ
Concentration 0.2mg/mL
Antigen NK-1.1
Regulatory Status RUO
Purification Method Affinity Purified
Formulation Aqueous buffered solution containing ≤0.09% sodium azide.
Immunogen Mouse NK-1+ Spleen and Bone Marrow Cells
Classification Monoclonal
Primary or Secondary Primary
Clone PK136
24

Streptococcus A Rabbit anti-Streptococcus, Unconjugated, Polyclonal, MilliporeSigma™

Rabbit Polyclonal Antibody

Content And Storage 2 to 8°C. For long-term storage, freeze at -20°C.
Target Species Streptococcus species
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA,Immunodiffusion
Form Purified
Research Discipline Infectious Diseases
Antigen Streptococcus A
Purification Method Ion-Exchange Purified
Gene Alias Rabbit anti-Strptococcus A
Immunogen Intact molecule Streptococcus A after disruption
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specific for Group A Streptococcus
25

Streptococcus A Rabbit anti-Streptococcus, Unconjugated, Polyclonal, MilliporeSigma™

Rabbit Polyclonal Antibody

Content And Storage 2 to 8°C. For long-term storage, freeze at -20°C.
Purification Method Ion-Exchange Purified
Gene Alias Rabbit anti-Strptococcus A
Target Species Streptococcus species
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA,Immunodiffusion
Form Purified
Immunogen Fragment of Streptococcus A after disruption
Classification Polyclonal
Primary or Secondary Primary
Research Discipline Infectious Diseases
Test Specificity Specific for Group A Streptococcus
26

Invitrogen™ Donkey anti-Rabbit IgG (H+L) Highly Cross-Adsorbed Secondary Antibody, Alexa Fluor™ 488

Donkey Polyclonal Secondary Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark
Target Species Rabbit
Host Species Donkey
Conjugate Alexa Fluor 488
Applications Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunocytochemistry
Form Liquid
Isotype IgG
Concentration 2 mg/mL
Antigen Rabbit IgG (H+L) Highly Cross-Adsorbed
Regulatory Status RUO
Purification Method Purified
Product Type Secondary Antibody
Formulation PBS with 5mM sodium azide; pH 7.5
Immunogen Gamma Immunoglobins Heavy and Light chains.
Classification Polyclonal
Primary or Secondary Secondary
27

Invitrogen™ Goat anti-Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, Alexa Fluor™ 488

Goat Polyclonal Secondary Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark
Target Species Mouse
Host Species Goat
Conjugate Alexa Fluor 488
Applications Flow Cytometry,Immunohistochemistry,Immunocytochemistry
Form Liquid
Isotype IgG
Concentration 2 mg/mL
Antigen Mouse IgG (H+L) Cross-Adsorbed
Regulatory Status RUO
Purification Method Purified
Product Type Secondary Antibody
Formulation PBS with 5mM sodium azide; pH 7.5
Immunogen Gamma Immunoglobins Heavy and Light chains.
Classification Polyclonal
Primary or Secondary Secondary
28

Invitrogen™ Goat anti-Mouse IgG (H+L) Secondary Antibody, HRP

Goat Polyclonal Secondary Antibody

EDGE
Content And Storage 4°C
Target Species Mouse
Host Species Goat
Conjugate HRP
Applications ELISA,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
Form Lyophilized
Isotype IgG
Concentration 0.8 mg/mL
Antigen Mouse IgG (H+L)
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Product Type Secondary Antibody
Formulation PBS with 50mM sucrose, 15mg/mL BSA and no preservative; pH 7.6
Classification Polyclonal
Primary or Secondary Secondary
29

Streptococcus Group A, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against Streptococcus Group A.

30

Invitrogen™ Phospho-Tau (Ser202, Thr205) Monoclonal Antibody (AT8)
GSA_VA GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human,Mouse
Host Species Mouse
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P10636, P10637
Isotype IgG1 κ
Concentration 0.2 mg/mL
Antigen Phospho-Tau (Ser202, Thr205)
Gene Symbols MAPT
Regulatory Status RUO
Purification Method Protein A
Gene Alias AI413597; AW045860; DDPAC; FLJ31424; FTDP17; FTDP-17; G protein beta1/gamma2 subunit-interacting factor 1; map tau; Mapt; MAPTL; MGC138549; microtubule associated protein tau; microtubule-associated protein tau; microtubule-associated protein tau, isoform 4; microtubules; MSTD; Mtapt; MTBT1; MTBT2; Neurofibrillary tangle protein; neurofibrillary tangles; Neuronal Marker; paired helical filament-tau; PHFtau; PHF-tau; PPND; PPP1R103; protein phosphatase 1, regulatory subunit 103; pTau; RNPTAU; Tau; Tau microtubule-associated protein; tau protein; Tau-4; Tau5; Unknown (protein for MGC:134287)
Gene MAPT
Product Type Antibody
Gene ID (Entrez) 17762, 4137
Formulation PBS with no preservative
Immunogen Partially purified human PHF-Tau.
Classification Monoclonal
Primary or Secondary Primary
Clone AT8