Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.

Search Within Results

16 – 30 of 1,722,435 results

Promotions Available

Normal Rabbit IgG, Negative Control, R&D Systems™

Rabbit Polyclonal Antibody has been used in 64 publications

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Rabbit
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Control
Isotype	IgG
Concentration	LYOPH
Antigen	IgG
Gene Symbols	IGHG1
Purification Method	Protein A or G purified
Dilution	Control
Gene Alias	Immunoglobulin G, ImmunoglobulinG
Gene ID (Entrez)	3500
Immunogen	NA
Classification	Polyclonal
Reconstitution	Dissolve the lyophilized rabbit IgG in sterile PBS, pH 7.4. If 1 mL of PBS is used, the antibody concentration will be 1 mg/mL.
Test Specificity	Serum was obtained from naive (non-immunized) rabbits and purified for use as normal rabbit IgG.

TDP-43/TARDBP Antibody (2E2-D3), Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Target Species	Human,Mouse,Rat,Bacteria,Insect,Monkey,Firefly
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot,ELISA,Immunohistochemistry,Immunocytochemistry,Immunoprecipitation,Immunohistochemistry (Paraffin),Functional Assay,KnockDown
Form	Purified
Isotype	IgG1 κ
Gene Accession No.	Q13148
Research Discipline	Cell Cycle and Replication, Chromatin Research, DNA replication Transcription Translation and Splicing, Epigenetics, Immunology, Mitochondrial Fusion Proteins, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Transcription Factors and Regulators, Virology Bacteria and Parasites
Antigen	TDP-43/TARDBP
Regulatory Status	RUO
Purification Method	IgG purified
Dilution	Western Blot 1:500, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence 1:10-1:500, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Functional, Knockdown Validated
Gene Alias	ALS10TAR DNA-binding protein-43, TAR DNA binding protein, TDP43, TDP-43, TDP-43TAR DNA-binding protein 43
Gene ID (Entrez)	23435
Formulation	In 1x PBS, pH 7.4
Classification	Monoclonal
Immunogen	TARDBP (NP_031401.1, 1 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA
Primary or Secondary	Primary
Clone	2E2-D3

p62/SQSTM1 Antibody (2C11), Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Target Species	Human,Mouse,Rat,Bovine,Hamster,Rabbit
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot,ELISA,Immunohistochemistry,Immunocytochemistry,Immunoprecipitation,Immunohistochemistry (Paraffin),Immunohistochemistry (Frozen)
Form	Purified
Isotype	IgG2a κ
Gene Accession No.	Q13501
Research Discipline	Adaptive Immunity, Cancer, Chromatin Modifiers, Chromatin Research, DNA Methyltransferases, Epigenetics, Innate Immunity, Tumor Suppressors
Antigen	p62/SQSTM1
Regulatory Status	RUO
Purification Method	IgG purified
Dilution	Western Blot 1:100-1:2000, ELISA, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence 10μg/mL, Immunoprecipitation 1:10-1:1000, Immunohistochemistry-Paraffin 1:10-1:500, Immunohistochemistry-Frozen 1:10-1:500
Gene Alias	A170, Autophagy Receptor P62, DMRV, EBI3-associated protein of 60 kDa, EBI3-associated protein p60, EBIAP, FTDALS3, NADGP, ORCA, OSIL, oxidative stress induced like, p60PDB3, p62, p62B, Paget disease of bone 3, PDB3, phosphotyrosine independent ligand for the Lck SH2 domain p62, Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa, sequestosome 1, sequestosome-1, Ubiquitin-binding protein p62, ZIP3
Gene ID (Entrez)	8878
Formulation	In 1x PBS, pH 7.4
Classification	Monoclonal
Immunogen	SQSTM1 (AAH03139.1, 1 a.a. ~ 440 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL
Primary or Secondary	Primary
Clone	2C11

Cadherin-11 Antibody (1A5), Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot,Flow Cytometry,ELISA,Immunohistochemistry,Immunoprecipitation,Functional Assay
Form	Purified
Isotype	IgG
Gene Accession No.	P55287
Research Discipline	Cancer
Antigen	Cadherin-11
Regulatory Status	RUO
Purification Method	IgG purified
Dilution	Western Blot, Flow Cytometry, ELISA, Immunohistochemistry, Immunoprecipitation, Functional
Gene Alias	CAD11OSF-4, cadherin 11, type 2, OB-cadherin (osteoblast), cadherin-11, CDHOB, OB, OB-cadherin, Osteoblast cadherin
Gene ID (Entrez)	1009
Formulation	In 1x PBS, pH 7.4
Classification	Monoclonal
Immunogen	CDH11 (P55287, 54 a.a. ~ 612 a.a) partial recombinant protein with Fc tag at C terminal. MW of the Fc tag alone is 50 KDa. 0
Primary or Secondary	Primary
Clone	1A5

beta-III Tubulin Antibody, Novus Biologicals™

Chicken Polyclonal Antibody has been used in 16 publications

Pricing & Availability
Specifications

Antigen	beta-III Tubulin
Regulatory Status	RUO
Content And Storage	Store at 4C in the dark.
Target Species	Human,Mouse,Rat
Host Species	Chicken
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin),Immunohistochemistry (Whole-Mount),KnockDown,Western Blot
Gene ID (Entrez)	10381
Classification	Polyclonal
Immunogen	Chickens were immunized with three synthetic peptide/keyhole limpet hemocyanin (KLH) conjugates. These synthetic peptides corresponded to different regions of the beta-Tubulin 3 gene product, but are shared between the human (NP_AAL28094, NCBI) and rat (AAM28438, NCBI) protein sequences.
Primary or Secondary	Primary

Promotions Available

Human/Mouse/Rat CD31/PECAM-1 Antibody, R&D Systems™

Goat Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Chicken,Cynomolgus Monkey,Golden Syrian Hamster,Human,Mouse,Pig,Primate,Rabbit,Rat,Rhesus Macaque,Transgenic Mouse,Xenograft
Host Species	Goat
Conjugate	Unconjugated
Applications	Cell Culture,Cell Selection,CyTOF,Flow Cytometry,Functional Assay,Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),In vivo Assay,Simple Western,Western Blot
Isotype	IgG
Gene Accession No.	Q08481
Concentration	LYOPH
Antigen	CD31/PECAM-1
Gene Symbols	PECAM1
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 0.5 ug/mL, Flow Cytometry 0.25 ug/10^6 cells, Immunohistochemistry 3-15 ug/mL, Immunocytochemistry 5-15 ug/mL, CyTOF-ready
Gene Alias	adhesion molecule, CD31, CD31 antigen, CD31/EndoCAM, EndoCAM, FLJ34100, FLJ58394, GPIIA', PECA1, PECAM1, PECAM-1, PECAM-1, CD31/EndoCAM, platelet endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1, platelet/endothelial cell adhesion molecule
Gene ID (Entrez)	5175
Immunogen	Mouse myeloma cell line NS0-derived recombinant mouse CD31/PECAM-1 Glu18-Lys590 Accession # Q08481
Classification	Polyclonal
Reconstitution	Reconstitute at 0.2 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects mouse CD31/PECAM-1 in direct ELISAs and Western blots. In direct ELISAs and Western blots, approximately 10% cross-reactivity with recombinant human CD31 and recombinant porcine CD31 is observed. Detects mouse CD31 and rat CD31 in flow cytometry.

AIF-1/Iba1 Antibody, Novus Biologicals™

Goat Polyclonal Antibody has been used in 192 publications

Pricing & Availability
Specifications

Content And Storage	Store at -20C. Avoid freeze-thaw cycles.
Target Species	Canine,Mouse,Equine,Feline,Human,Mouse,Pig,Rat
Host Species	Goat
Conjugate	Unconjugated
Applications	Dual RNAScope ISH-IHC,Gene Knock-Out,Immunocytochemistry,Immunofluorescence,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Free Floating),Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunohistochemistry (Whole-Mount),Immunoprecipitation,Peptide ELISA,Western Blot
Isotype	IgG
Gene Accession No.	P55008
Research Discipline	Autoimmune Diseases, Cancer, Cell Biology, Cell Cycle and Replication, Immunology, Inflammation, Lipid and Metabolism, Microglia Markers, Neuroscience
Concentration	0.5 mg/mL
Antigen	AIF-1/Iba1
Gene Symbols	AIF1
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 0.1 - 1.0 ug/mL, Immunohistochemistry 4 - 6 ug/mL, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 4 - 6 ug/mL, Immunohistochemistry-Frozen, Peptide ELISA Detection Limit 1:128000, Immunohistochemistry Free-Floating, Immunohistochemistry (Whole-Mount), Knockout Validated, Dual RNAscope ISH-IHC
Molecular Weight of Antigen	16.8 kDa
Gene Alias	AIF-1, allograft inflammatory factor 1, G1, IBA1, IbaI, interferon gamma responsive transcript, Ionized calcium-binding adapter molecule 1, IRT1, IRT-1, Protein G1
Gene ID (Entrez)	199
Formulation	Tris saline (20 mM Tris pH 7.3, 150 mM NaCl), 0.5% BSA with 0.02% Sodium Azide
Classification	Polyclonal
Immunogen	This AIF-1/Iba1 Antibody was developed against a peptide with sequence C-TGPPAKKAISELP, from the C Terminus of the protein sequence according to NP_116573.1; NP_001614.3.
Primary or Secondary	Primary
Test Specificity	This AIF-1/Iba1 Antibody is expected to recognize isoform 1 (NP_116573.1) and isoform 3 (NP_001614.3). AIF-1/Iba1 is thought to be involved in negative regulation of growth of vascular smooth muscle cells, which contributes to the anti-inflammatory response to vessel wall trauma.

Mouse anti-Human IgG1 Fc Secondary Antibody (2C11cc), Allophycocyanin, Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Antigen	IgG1 Fc
Regulatory Status	RUO
Content And Storage	Store at 4°C in the dark.
Target Species	Human
Host Species	Mouse
Conjugate	APC
Applications	ELISA,Immunodiffusion,Immunohistochemistry,Immunohistochemistry (Frozen)
Form	Purified
Classification	Monoclonal
Immunogen	Hybridoma clone has been derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice immunized with IgG from human serum.
Primary or Secondary	Secondary
Clone	2C11cc

p62/SQSTM1 Antibody (2533B) - BSA Free, Novus Biologicals™

Rabbit Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Gene Knock-Out,Immunocytochemistry/Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin),Simple Western,Western Blot
Form	Purified
Research Discipline	Adaptive Immunity, Cancer, Chromatin Modifiers, Chromatin Research, DNA Methyltransferases, Epigenetics, Innate Immunity, Tumor Suppressors
Concentration	1.0 mg/mL
Antigen	p62/SQSTM1
Regulatory Status	RUO
Purification Method	Protein A or G purified
Dilution	Western Blot 1 μg/ml, Simple Western 20 μg/ml, Immunohistochemistry 8-25 μg/ml, Immunocytochemistry/ Immunofluorescence 8-25 μg/ml, Immunohistochemistry-Paraffin 8-25 μg/ml, Knockout Validated
Gene Alias	A170, Autophagy Receptor P62, DMRV, EBI3-associated protein of 60 kDa, EBI3-associated protein p60, EBIAP, FTDALS3, NADGP, ORCA, OSIL, oxidative stress induced like, p60PDB3, p62, p62B, Paget disease of bone 3, PDB3, phosphotyrosine independent ligand for the Lck SH2 domain p62, Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa, sequestosome 1, sequestosome-1, Ubiquitin-binding protein p62, ZIP3
Gene ID (Entrez)	8878
Formulation	PBS
Classification	Monoclonal
Immunogen	Partial recombinant human p62/SQSTM1 protein produced in E. coli (amino acids 368-440) [UniProt Q13501]
Primary or Secondary	Primary
Clone	2533B

Promotions Available

Human/Mouse IL-12/IL-35 p35 Antibody, R&D Systems™

Mouse Monoclonal Antibody has been used in 12 publications

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species	Human,Mouse,Hamadryas Baboon
Host Species	Mouse
Conjugate	Unconjugated
Applications	Bioassay,CyTOF,ELISA Development,Flow Cytometry,Flow Cytometry (Intracellular Staining),Immunoprecipitation,Neutralization,Western Blot
Form	Ascites
Isotype	IgG1
Gene Accession No.	P29459
Concentration	LYOPH
Antigen	IL-12/IL-35 p35
Gene Symbols	IL12A
Regulatory Status	RUO
Purification Method	Protein A or G purified from ascites
Dilution	Western Blot 1 ug/mL, Intracellular Staining by Flow Cytometry 2.5 ug/10^6 cells, CyTOF-ready
Gene ID (Entrez)	3592
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
Immunogen	S. frugiperda insect ovarian cell line Sf 21-derived recombinant human IL-12/IL-35 p35 Arg23-Ser219 Accession # P29459
Classification	Monoclonal
Reconstitution	Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary	Primary
Test Specificity	Detects human IL-12/IL-35 p35 in direct ELISAs and Western blots. Detects the p35 subunit either as part of a p40/p35 heterodimer or as a free subunit after reduction of the heterodimer. This antibody does not recognize IL-12 p40 homodimers but shows strong cross-reactivity with the p35 subunits from porcine and mouse systems.
Clone	27537

Human AMPKβ1 Antibody, Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70°CC as supplied. 1 month, 2 to 8°CC under sterile conditions after reconstitution. 6 months, -20 to -70°CC under sterile conditions after reconstitution.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry,Simple Western,Western Blot
Form	Purified
Isotype	IgG2b
Gene Accession No.	Q9Y478
Antigen	AMPK beta 1
Regulatory Status	RUO
Purification Method	Protein A or G purified from hybridoma culture supernatant
Dilution	Western Blot 1 μg/mL, Simple Western 10 μg/mL, Immunohistochemistry 0.5-25 μg/mL
Gene Alias	5'-AMP-activated protein kinase beta-1 subunit, AMP-activated protein kinase beta subunit, AMPK, AMPK beta -1 chain, AMPK beta 1,5'-AMP-activated protein kinase subunit beta-1, AMPK subunit beta-1, AMPKb, HAMPKb, MGC17785, PRKAB1, protein kinase, AMP-activated, beta 1 non-catalytic subunit, protein kinase, AMP-activated, noncatalytic, beta-1
Gene ID (Entrez)	5564
Formulation	Lyophilized from a 0.2μm filtered solution in PBS with Trehalose. See Certificate of Analysis for details. *Small pack size (-SP) is supplied either lyophilized or as a 0.2μm filtered solution in PBS.
Immunogen	E. coli- derived recombinant human AMPKbeta1, Met1-Ile270, Accession # Q9Y478
Classification	Monoclonal
Reconstitution	Reconstitute lyophilized material at 0.2 mg/ml in sterile PBS. For liquid material, refer to CoA for concentration.
Primary or Secondary	Primary
Clone	1092531

FGF-21 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Immunohistochemistry (Paraffin),Simple Western,Western Blot
Form	Purified
Gene Accession No.	Q9NSA1
Research Discipline	Angiogenesis, Cancer
Concentration	0.5 mg/mL
Antigen	FGF-21
Regulatory Status	RUO
Purification Method	Affinity purified
Dilution	Western Blot 0.2-1 μg/mL, Simple Western 1:100, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Alias	FGF-21, fibroblast growth factor 21
Gene ID (Entrez)	26291
Formulation	PBS, 2% Sucrose
Classification	Polyclonal
Immunogen	Synthetic peptides corresponding to FGF21(fibroblast growth factor 21) The peptide sequence was selected from the N terminal of FGF21 (NP_061986). Peptide sequence DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT.
Primary or Secondary	Primary

MTAP Antibody (2G4), Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot,ELISA,Immunohistochemistry,Immunocytochemistry,Immunohistochemistry (Paraffin)
Form	Purified
Isotype	IgG1 κ
Gene Accession No.	AAH18625
Antigen	MTAP
Regulatory Status	RUO
Purification Method	IgG purified
Dilution	Western Blot 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin
Gene Alias	5'-methylthioadenosine phosphorylase, c86fus, EC 2.4.2.28, methylthioadenosine phosphorylase, MSAPMeSAdo phosphorylase, MTA phosphorylase, MTAPase, S-methyl-5'-thioadenosine phosphorylase
Gene ID (Entrez)	4507
Formulation	In 1x PBS, pH 7.4
Classification	Monoclonal
Immunogen	MTAP (AAH18625, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS
Primary or Secondary	Primary
Clone	2G4

Invitrogen™ Goat anti-Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, Alexa Fluor™ 488

Goat Polyclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Rabbit
Host Species	Goat
Conjugate	Alexa Fluor 488
Applications	Flow Cytometry,Immunocytochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin)
Form	Liquid
Isotype	IgG
Concentration	2 mg/mL
Antigen	Rabbit IgG (H+L) Cross-Adsorbed
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Product Type	Secondary Antibody
Formulation	PBS with 5mM sodium azide; pH 7.5
Immunogen	Gamma Immunoglobins Heavy and Light chains.
Classification	Polyclonal
Primary or Secondary	Secondary

Invitrogen™ Goat anti-Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, Alexa Fluor™ 488

Goat Polyclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Mouse
Host Species	Goat
Conjugate	Alexa Fluor 488
Applications	Flow Cytometry,Immunohistochemistry,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	2 mg/mL
Antigen	Mouse IgG (H+L) Cross-Adsorbed
Regulatory Status	RUO
Purification Method	Purified
Product Type	Secondary Antibody
Formulation	PBS with 5mM sodium azide; pH 7.5
Immunogen	Gamma Immunoglobins Heavy and Light chains.
Classification	Polyclonal
Primary or Secondary	Secondary

Antibodies

Filtered Search Results

Narrow Results

Normal Rabbit IgG, Negative Control, R&D Systems™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

TDP-43/TARDBP Antibody (2E2-D3), Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

p62/SQSTM1 Antibody (2C11), Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Cadherin-11 Antibody (1A5), Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

beta-III Tubulin Antibody, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

AIF-1/Iba1 Antibody, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Mouse anti-Human IgG1 Fc Secondary Antibody (2C11cc), Allophycocyanin, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

p62/SQSTM1 Antibody (2533B) - BSA Free, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Human/Mouse IL-12/IL-35 p35 Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Human AMPKβ1 Antibody, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

FGF-21 Antibody, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

MTAP Antibody (2G4), Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Normal Rabbit IgG, Negative Control, R&D Systems™

TDP-43/TARDBP Antibody (2E2-D3), Novus Biologicals™

p62/SQSTM1 Antibody (2C11), Novus Biologicals™

Cadherin-11 Antibody (1A5), Novus Biologicals™

beta-III Tubulin Antibody, Novus Biologicals™

AIF-1/Iba1 Antibody, Novus Biologicals™

Mouse anti-Human IgG1 Fc Secondary Antibody (2C11cc), Allophycocyanin, Novus Biologicals™

p62/SQSTM1 Antibody (2533B) - BSA Free, Novus Biologicals™

Human/Mouse IL-12/IL-35 p35 Antibody, R&D Systems™

Human AMPKβ1 Antibody, Novus Biologicals™

FGF-21 Antibody, Novus Biologicals™

MTAP Antibody (2G4), Novus Biologicals™