Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.

Search Within Results

3,616 – 3,630 of 1,885,970 results

3,616

Invitrogen™ F(ab)-Goat anti-Human IgG (H+L) Superclonal™ Secondary Antibody

F(ab)-Goat Recombinant Superclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Goat
Conjugate	Unconjugated
Applications	ELISA,Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG F(ab)
Concentration	1.0 mg/mL
Antigen	Human IgG (H+L)
Regulatory Status	RUO
Purification Method	Affinity chromatography
Product Type	Secondary Antibody
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Purified Human IgG.
Classification	Recombinant Superclonal
Primary or Secondary	Secondary

3,617

Invitrogen™ MAP2 Monoclonal Antibody (M13)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P11137, P15146, P20357
Isotype	IgG1 κ
Concentration	0.5 mg/mL
Antigen	MAP2
Gene Symbols	Map2
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	a730034c02; AC091465.1; DKFZp686I2148; G1-397-34; MAP 2; Map2; MAP-2; map2.S; map2a; map-2a; map2ab; MAP2B; MAP2C; MAP2R; microtubule associated protein 2; microtubule associated protein 2 S homeolog; microtubule associated protein 2; microtubule-associated protein 2; microtubule associated protein 2C; microtubule-associated protein 2; microtubule-associated protein-2; Mtap2; Mtap-2; OTTHUMP00000163916; OTTHUMP00000208143; repro4; XELAEV_18047318mg; xmap2
Gene	Map2
Product Type	Antibody
Gene ID (Entrez)	17756, 25595, 4133
Formulation	PBS with 0.1% sodium azide; pH 7.4
Immunogen	MAPs.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	M13

3,618

Invitrogen™ Ly-6G/Ly-6C Monoclonal Antibody (RB6-8C5), Pacific Orange™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Mouse
Host Species	Rat
Conjugate	Pacific Orange
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P0CW02, P0CW03, P35461
Isotype	IgG2b
Concentration	0.1 mg/mL
Antigen	Ly-6G/Ly-6C
Gene Symbols	Ly6c1, Ly6c2, Ly6g
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	AA682074; AA959465; Gr1; Gr-1; Granulocyte Marker; Ly6c; Ly-6C; Ly-6C.2; Ly6c1; Ly-6C1; Ly6c2; Ly-6C2; Ly6g; Ly-6G; ly-6G.1; lymphocyte antigen 6 complex, locus C; lymphocyte antigen 6 complex, locus C1; lymphocyte antigen 6 complex, locus C2; lymphocyte antigen 6 complex, locus G; lymphocyte antigen 6C precursor (Ly-6C); lymphocyte antigen 6C1; Lymphocyte antigen 6C2; lymphocyte antigen 6G; Lymphocyte antigen Ly-6C; lymphocyte differentiation antigen; PML; PMN
Gene	Ly6c2
Product Type	Antibody
Gene ID (Entrez)	100041546, 17067, 546644
Formulation	PBS with 4mg/mL BSA and 0.1% sodium azide
Immunogen	Normal murine bone marrow cells.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	RB6-8C5

3,619

Invitrogen™ CD62L Monoclonal Antibody (MEL-14), APC-Cyanine7

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	APC-Cyanine7
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P18337
Isotype	IgG2a κ
Concentration	0.1 mg/mL
Antigen	CD62L
Gene Symbols	SELL
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	A.11; AI528707; CD62 antigen-like family member L; CD62L; gp90-MEL; hLHRc; LAM1; LAM-1; LECAM1; LECAM-1; LEU8; Leu-8; Leukocyte adhesion molecule 1; leukocyte surface antigen Leu-8; Leukocyte-endothelial cell adhesion molecule 1; LNHR; LSEL; L-selectin; Ly22; Ly-22; LYAM1; Lyam-1; Ly-m22; Lymph node homing receptor; lymphocyte adhesion molecule 1; lymphocyte antigen 22; Lymphocyte surface MEL-14 antigen; pln homing receptor; PLNHR; SELE; selectin E (endothelial adhesion molecule 1); selectin L; selectin L (lymphocyte adhesion molecule 1); selectin, lymphocyte; Sell; TQ1
Gene	SELL
Product Type	Antibody
Gene ID (Entrez)	20343
Formulation	PBS with proprietary stabilizer and <0.1% sodium azide; pH 7.1
Immunogen	C3H/eb mouse B-cell lymphoma, 38C13.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MEL-14

3,620

Invitrogen™ c-Kit Monoclonal Antibody (104D2), FITC

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Bovine,Human,Monkey
Host Species	Mouse
Conjugate	FITC
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P10721, P43481
Isotype	IgG1 κ
Antigen	c-Kit
Gene Symbols	KIT
Regulatory Status	RUO
Purification Method	Size-exclusion chromatography
Gene Alias	belly-spot; Bs; CD117; ckit; C-Kit; c-KIT gene1; c-kit protein; c-kit proto-oncogene protein; c-kit receptor; c-kit receptor tyrosine kinase; dominant spotting; Dominant white spotting; Fdc; Gsfsco1; Gsfsco5; Gsfsow3; KIT; kit oncogene; KIT proto-oncogene receptor tyrosine kinase; KIT proto-oncogene, receptor tyrosine kinase; mast cell growth factor receptor; mast/stem cell growth factor receptor; mast/stem cell growth factor receptor Kit; MGF; p145 c-kit; PBT; Piebald trait protein; protein kinase; proto-oncogene c-Kit; proto-oncogene tyrosine-protein kinase Kit; receptor tyrosine kinase c-kit; receptor tyrosine kinase type III; SCFR; SCO1; SCO5; Sl; soluble KIT variant 1; SOW3; spotted sterile male; Ssm; Steel Factor Receptor; Tr-kit; tyrosine kinase receptor; tyrosine kinase receptor c-KIT; tyrosine-protein kinase Kit; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein; W
Gene	KIT
Product Type	Antibody
Gene ID (Entrez)	280832, 3815
Formulation	PBS with 0.2% BSA and 15mM sodium azide; pH 7.4
Immunogen	MOLM-1 megakaryocytic cells.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	104D2

3,621

Invitrogen™ CD300e (IREM-2) Monoclonal Antibody (UP-H2), APC, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	Q496F6
Isotype	IgG1
Concentration	5 μL/Test
Antigen	CD300e (IREM-2)
Gene Symbols	CD300E
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	BC034097; CD300 antigen like family member E; CD300 antigen-like family member E; CD300e; CD300e antigen; CD300e molecule; Cd300le; CLM2; CLM-2; CMRF35A5; CMRF35-A5; CMRF35-like molecule 2; CMRF-35-like molecule-1; Immune receptor expressed on myeloid cells 2; IREM2; IREM-2; PIgR2; PIgR-2; poly-Ig receptor 2; polymeric immunoglobulin receptor 2; TREM5
Gene	CD300E
Product Type	Antibody
Gene ID (Entrez)	342510
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	UP-H2

3,622

Invitrogen™ GFAP Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P03995, P14136, P47819
Isotype	IgG
Concentration	0.72 mg/mL
Antigen	GFAP
Gene Symbols	GFAP
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	6330404F12Rik; 65 kDa glutamic acid decarboxylase; AI836096; ALXDRD; Astrocyte or Intermediate Filament Protein; cb345; class III intermediate filament protein; etID36982.3; FLJ45472; GAD(65); Gad2; Gad-2; GAD65; GAD-65; GFAP; GFAP epsilon; gfap protein; gfapl; glial fibrillary acidic protein; Glial Fibrillary Acidic Protein (GFAP); glial fibrillary acidic protein alpha; glutamate decarboxylase 2; Glutamate decarboxylase 65 kDa isoform; glutamic acid decarboxylase 2; I79_011607; intermediate filament; intermediate filament protein; intermediate filament protein; GFAP; Unknown (protein for MGC:139638); wu:fb34h11; wu:fk42c12; xx:af506734; zgc:110485; zGFAP; intermediate filament protein; zrf-1 antigen
Gene	GFAP
Product Type	Antibody
Gene ID (Entrez)	14580, 24387, 2670
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human GFAP. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

3,623

Invitrogen™ NPR3 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat,Rabbit,Chicken
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Western Blot,Western Blot
Form	Liquid
Gene Accession No.	P17342, P41740, P70180
Isotype	IgG
Concentration	1.77 mg/mL
Antigen	NPR3
Gene Symbols	NPR3
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	A NPR-C; ANP-C; ANP-CR; ANPRC; ANPR-C; atrial natriuretic peptide clearance receptor; Atrial natriuretic peptide clearence receptor 3; atrial natriuretic peptide C-type receptor; atrial natriuretic peptide receptor 3; atrial natriuretic peptide receptor 3-like; atrial natriuretic peptide receptor type C; atrionatriuretic peptide receptor C; C5orf23; EF-2; guanylate cyclase C; GUCY2B; lgj; longjohn; natriuretic peptide receptor 3; natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C); Nppc receptor; Npr3; NPRC; NPR-C; stri; strigosus
Gene	NPR3
Product Type	Antibody
Gene ID (Entrez)	100354361, 18162, 25339, 431663, 4883
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human NPR-C. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

3,624

Invitrogen™ HTR2A Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P14842, P28223
Isotype	IgG
Concentration	500 μg/mL
Antigen	HTR2A
Gene Symbols	Htr2a
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	5-HT-2; 5Ht-2; 5-HT2 receptor; 5-HT2A; 5-HT-2A; 5HT2A Receptor; 5-HT2A receptor; 5-HT2A/2C; 5-HT2A/2C receptor; 5-hydroxytryptamine (serotonin) receptor 2A; 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled; 5-hydroxytryptamine 2 receptor; 5-hydroxytryptamine receptor 2A; E030013E04; Htr2; Htr-2; HTR2A; serotonin 5HT-2 receptor; serotonin 5-HT-2A receptor; serotonin receptor 2A; SR2A
Gene	Htr2a
Product Type	Antibody
Gene ID (Entrez)	29595, 3356
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) .
Classification	Polyclonal
Primary or Secondary	Primary

3,625

Invitrogen™ SHP2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	P35235, P41499, Q06124
Isotype	IgG
Concentration	500 μg/mL
Antigen	SHP2
Gene Symbols	PTPN11
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	2700084A17Rik; AW536184; bptp3; CFC; cSH-PTP2; encodes catalytic domain; HCP; HGNC:9644; JMML; METCDS; MGC14433; Noonan syndrome 1; ns1; null; OTTHUMP00000166108; phosphotyrosyl-protein phosphatase; protein tyrosine phosphatase non-receptor type 11; protein tyrosine phosphatase SH-PTP2; protein tyrosine phosphatase, non-receptor type 11; protein tyrosine phosphatase, non-receptor type 11 (Noonan syndrome 1); protein tyrosine phosphatase, non-receptor type 11 S homeolog; protein-tyrosine phosphatase 1D; Protein-tyrosine phosphatase 2C; protein-tyrosine phosphatase SYP; PTP1C; PTP1D; PTP-1D; ptp-2; PTP2C; PTP-2C; Ptpn11; ptpn11.S; ptpn11-a; ptpn11-b; SAP-2; SH2 domain-containing protein tyrosine phosphatase-2; Shp2; shp-2; SHPTP2; SH-PTP2; SH-PTP2 protein tyrosine phosphatase non-receptor type 11; SH-PTP2 protein tyrosine phosphatase, non-receptor type 11; SH-PTP3; Syp; Tyrosine-protein phosphatase non-receptor type 11; XELAEV_18010676mg
Gene	PTPN11
Product Type	Antibody
Gene ID (Entrez)	19247, 25622, 5781
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human SHP2 (582-597aa RVYENVGLMQQQKSFR).
Classification	Polyclonal
Primary or Secondary	Primary

3,626

Invitrogen™ EpoR Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P14753, P19235, Q07303
Isotype	IgG
Concentration	1.16 mg/mL
Antigen	EpoR
Gene Symbols	EPOR
Regulatory Status	RUO
Purification Method	Affinity Chromatography
Gene Alias	EPO R; EPOR; EPO-R; Erythropoietin receptor; pEpoR
Gene	EPOR
Product Type	Antibody
Gene ID (Entrez)	13857, 2057, 24336
Formulation	PBS with 50% glycerol and 0.01% thimerosal; pH 7.3
Immunogen	Synthetic peptide.
Classification	Polyclonal
Primary or Secondary	Primary

3,627

Invitrogen™ TIPARP Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C or -80°C if preferred
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	Q7Z3E1
Isotype	IgG
Concentration	1 mg/mL
Antigen	TIPARP
Gene Symbols	TIPARP
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	ADP-ribosyltransferase diphtheria toxin-like 14; ARTD14; AW558171; DDF1; DKFZP434J214; DKFZp686N0351; DKFZp686P1838; FLJ40466; PARP-1; PARP7; PARP-7; pART14; Poly [ADP-ribose] polymerase 7; protein mono-ADP-ribosyltransferase TIPARP; RM1; TCDD inducible poly(ADP-ribose) polymerase; TCDD-inducible poly [ADP-ribose] polymerase; TCDD-inducible poly(ADP-ribose) polymerase; TIPARP
Gene	TIPARP
Product Type	Antibody
Gene ID (Entrez)	25976
Formulation	PBS with 50% glycerol and 0.03% ProClin 300; pH 7.4
Immunogen	Recombinant Human TCDD-inducible poly [ADP-ribose] polymerase protein (74-178AA).
Classification	Polyclonal
Primary or Secondary	Primary

3,628

Invitrogen™ Phospho-MYPT1 (Ser507) Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Western Blot
Form	Liquid
Gene Accession No.	O14974
Isotype	IgG
Concentration	0.24 mg/mL
Antigen	Phospho-MYPT1 (Ser507)
Gene Symbols	PPP1R12A
Regulatory Status	RUO
Purification Method	Affinity Chromatography
Gene Alias	1200015F06Rik; 130 kDa myosin-binding subunit of smooth muscle myosin phophatase; 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130); 130 kDa myosin-binding subunit of smooth muscle myosin phosphatase; 130 kDa regulatory subunit of myosin phosphatase; 133kDa myosin-binding subunit of smooth muscle myosin phosphatase (M133); 5730577I22Rik; AA792106; AV099298; D10Ertd625e; hypothetical protein; I79_016312; LOW QUALITY PROTEIN: protein phosphatase 1 regulatory subunit 12A; M110; M130; M130 of smooth muscle myosin phosphatase; MBS; MBSP; myosin binding subunit; myosin phosphatase target subunit 1; myosin phosphatase, target subunit 1; myosin phosphatase-targeting subunit 1; myosin-binding subunit of myosin phosphatase; Mypt1; PP-1M; PP1M M110 subunit; PP1M subunit M110; Ppp1r12a; Protein phosphatase 1 regulatory subunit 12A; protein phosphatase 1, regulatory (inhibitor) subunit 12A; protein phosphatase 1, regulatory subunit 12A; protein phosphatase 1M 110 kda regulatory subunit; protein phosphatase myosin-binding subunit; Protein phosphatase subunit 1M; serine/threonine protein phosphatase PP1 smooth muscle regulatory subunit M110; si:dkey-28j4.1; smooth muscle myosin phosphatase myosin-binding subunit; unm p82emcf; unm_p82emcf; zgc:110448; zgc:110448 protein
Gene	PPP1R12A
Product Type	Antibody
Gene ID (Entrez)	4659
Formulation	PBS with 50% glycerol and 0.01% thimerosal; pH 7.3
Immunogen	Synthetic peptide
Classification	Polyclonal
Primary or Secondary	Primary

3,629

Invitrogen™ NKG2D Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C or -80°C if preferred
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P26718
Isotype	IgG
Concentration	0.6 mg/mL
Antigen	NKG2D
Gene Symbols	Klrk1
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	CD314; D12S2489E; D6H12S2489E; killer cell lectin like receptor K1; Killer cell lectin-like receptor subfamily K member 1; killer cell lectin-like receptor subfamily K, member 1; KLR; Klrk1; natural killer cell group 2D; natural killer cell receptor; NK cell receptor D; NK lectin-like receptor; Nkg2d; NKG2-D; NKG2-D type II integral membrane protein; NKG2-D-activating NK receptor; NKLLR; Nkrp2; NKR-P2; NKR-P2, ortholog of human NKG2D
Gene	Klrk1
Product Type	Antibody
Gene ID (Entrez)	22914
Formulation	PBS with 40% glycerol and 0.05% sodium azide; pH 7.4
Immunogen	Recombinant Human NKG2-D type II integral membrane protein (73-216AA).
Classification	Polyclonal
Primary or Secondary	Primary

3,630

Invitrogen™ Mesothelin Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin)
Form	Lyophilized
Gene Accession No.	Q61468
Isotype	IgG
Concentration	500 μg/mL
Antigen	Mesothelin
Gene Symbols	MSLN
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	CAK1; CAK1 antigen; megakaryocyte potentiating factor; Megakaryocyte-potentiating factor; Mes; Mesothelin; Mesothelin, cleaved form; MPF; MSLN; Pre-pro-megakaryocyte-potentiating factor; SMR; SMRP; soluble MPF mesothelin related protein
Gene	MSLN
Product Type	Antibody
Gene ID (Entrez)	56047
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	E.coli-derived mouse Mesothelin recombinant protein (Position: K308-L576).
Classification	Polyclonal
Primary or Secondary	Primary

Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ MAP2 Monoclonal Antibody (M13) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Ly-6G/Ly-6C Monoclonal Antibody (RB6-8C5), Pacific Orange™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD62L Monoclonal Antibody (MEL-14), APC-Cyanine7 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ c-Kit Monoclonal Antibody (104D2), FITC Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD300e (IREM-2) Monoclonal Antibody (UP-H2), APC, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GFAP Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NPR3 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ HTR2A Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SHP2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ EpoR Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TIPARP Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Phospho-MYPT1 (Ser507) Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NKG2D Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Mesothelin Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MAP2 Monoclonal Antibody (M13)

Invitrogen™ Ly-6G/Ly-6C Monoclonal Antibody (RB6-8C5), Pacific Orange™

Invitrogen™ CD62L Monoclonal Antibody (MEL-14), APC-Cyanine7

Invitrogen™ c-Kit Monoclonal Antibody (104D2), FITC

Invitrogen™ CD300e (IREM-2) Monoclonal Antibody (UP-H2), APC, eBioscience™

Invitrogen™ GFAP Polyclonal Antibody

Invitrogen™ NPR3 Polyclonal Antibody

Invitrogen™ HTR2A Polyclonal Antibody

Invitrogen™ SHP2 Polyclonal Antibody

Invitrogen™ EpoR Polyclonal Antibody

Invitrogen™ TIPARP Polyclonal Antibody

Invitrogen™ Phospho-MYPT1 (Ser507) Polyclonal Antibody

Invitrogen™ NKG2D Polyclonal Antibody

Invitrogen™ Mesothelin Polyclonal Antibody