Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.

Search Within Results

436 – 450 of 1,684,934 results

436

CD152 (CTLA-4) Monoclonal Antibody (14D3), APC, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Rhesus Macaque
Host Species	Mouse
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P16410
Concentration	5 μL/Test
Antigen	CD152 (CTLA-4)
Gene Symbols	CTLA4
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	ALPS5; CD; CD152; CD152 antigen; CD152 isoform; CD152 protein; CD152 protein precursor; celiac disease 3; CELIAC3; Ctla4; CTLA-4; cytotoxic T lymphocyte associated antigen 4 short spliced form; cytotoxic T-lymphocyte associated protein 4; cytotoxic T-lymphocyte protein 4; cytotoxic T-lymphocyte protein 4 isoform CTLA4-TM; cytotoxic T-lymphocyte-associated antigen 4; cytotoxic T-lymphocyte-associated protein 4; cytotoxic T-lymphocyte-associated serine esterase-4; EGK_04712; GRD4; GSE; ICOS; IDDM12; insulin-dependent diabetes mellitus 12; ligand and transmembrane spliced cytotoxic T lymphocyte associated antigen 4; Ly-56; sCTLA4; soluble form; transmembrane form
Gene	CTLA4
Product Type	Antibody
Gene ID (Entrez)	1493, 705673
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	14D3

437

Invitrogen™ APE1 Monoclonal Antibody (13B 8E5C2)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat,Canine,Monkey
Host Species	Mouse
Conjugate	Unconjugated
Applications	ChIP Assay,Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,RNA Immunoprecipitation,Immunocytochemistry
Form	Liquid
Gene Accession No.	P27695, P28352, P43138
Isotype	IgG2a
Concentration	1 mg/mL
Antigen	APE1
Gene Symbols	APEX1
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	AP endonuclease 1; AP endonuclease class I; AP lyase; Ape; APE1; APEN; Apex; APEX nuclease; APEX nuclease (multifunctional DNA repair enzyme) 1; APEX nuclease 1; Apex1; apurinic/a; Apurinic/apy; apurinic/apyrimidinic (abasic) endonuclease; apurinic/apyrimidinic endodeoxyribonuclease 1; apurinic/apyrimidinic endonuclease; apurinic/apyrimidinic endonuclease 1; Apurinic-apyrimidinic endonuclease 1; APX; BAP 1; BAP1; deoxyribonuclease (apurinic or apyrimidinic); DNA-(apurinic or apyrimidinic site) endonuclease; DNA-(apurinic or apyrimidinic site) lyase; DNA-(apurinic or apyrimidinic site) lyase, mitochondrial; HAP1; protein REF-1; redox factor 1; redox factor-1; REF1; REF-1
Gene	APEX1
Product Type	Antibody
Gene ID (Entrez)	11792, 328, 482558, 79116
Formulation	PBS with 0.05% sodium azide
Immunogen	Full-length recombinant human APE protein.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	13B 8E5C2

438

Invitrogen™ Goat anti-Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, Texas Red-X

Goat Polyclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Mouse
Host Species	Goat
Conjugate	Texas Red-X
Applications	Immunohistochemistry (Frozen),Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	2 mg/mL
Antigen	Mouse IgG (H+L) Cross-Adsorbed
Regulatory Status	RUO
Purification Method	Purified
Product Type	Secondary Antibody
Formulation	PBS with 5mM sodium azide; pH 7.5
Immunogen	Gamma Immunoglobins Heavy and Light chains.
Classification	Polyclonal
Primary or Secondary	Secondary

439

Invitrogen™ alpha Tubulin Polyclonal Antibody

Chicken Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human,Mouse,Rat
Host Species	Chicken
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	A6NHL2, P05213, P0DPH7, P68363, P68366, P68368, P68369, P68370, P68373, Q3KRE8, Q3UX10, Q5XIF6, Q6AYZ1, Q6P9V9, Q6PEY2, Q71U36, Q9BQE3, Q9BVA1, Q9CWF2
Isotype	IgY
Concentration	1 mg/mL
Antigen	alpha Tubulin
Gene Symbols	Tuba1a, Tuba1b, TUBA1C, TUBA3C, TUBA3E, TUBA4A, TUBAL3, TUBB2B
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	1t; a1t; ALPHA 84C; alpha tubulin; alpha tubulin 84B; alpha[[1]] tubulin; alpha[[1]]-tubulin; alpha1; alpha1 tubulin; alpha1t; alpha1tub; alpha1tub84B; alpha1-tubulin; alpha84B; alphaT; alphat-1; alphatub; alpha-tub; alphaTub1; alphatub84; alphaTUB84B; alpha-tub84B; alphaTub84B-PA; alphatubulin; alpha-tubulin; Alpha-tubulin 1; Alpha-tubulin 2; Alpha-tubulin 3; Alpha-tubulin 3C; alpha-tubulin 3C/D; Alpha-tubulin 3D; Alpha-tubulin 3E; alpha-tubulin 4; Alpha-tubulin 6; alphaTubulin 84B; alpha-tubulin 84B; alpha-Tubulin at 84B; alpha-tubulin I; Alpha-tubulin II; alpha-tubulin III; Alpha-tubulin isotype M-alpha-1; alpha-tubulin isotype M-alpha-2; Alpha-tubulin isotype M-alpha-4; alpha-tubulin isotype M-alpha-6; alpha-tubulin TUB1; alpha-tubulin ubiquitous; alphaTubulin84B; Alpha-Tubulin84B; ALS22; anon-EST:Liang-1.59; anon-EST:Liang-2.30; AT25469p; aTub84B; a-tub84B; bA408E5.3; B-ALPHA-1; bcm948; BEST:LD32507; cb944; CG1913; CG1913-PA; chr3R:2914276..2914416; clone 1.59; clone 2.30; Detyrosinated tubulin alpha-1A chain; Detyrosinated tubulin alpha-1B chain; Detyrosinated tubulin alpha-1C chain; Detyrosinated tubulin alpha-3 chain; Detyrosinated tubulin alpha-3C chain; Detyrosinated tubulin alpha-3D chain; Detyrosinated tubulin alpha-3E chain; DM1alpha; Dmel\CG1913; Dmel_CG1913; DTA1; fb22g06; FLJ30169; H2 ALPHA; H2-ALPHA; hum-a-tub1; hum-a-tub2; I79_019110; K-ALPHA-1; l(3)84Bd; l(3)g3; lis3; LOC100726777; LOC100731885; LOC100857858; LOC101118307; LOC106557476; M[a]4; M[a]6; ms(3)nc33; nc33; RGD1565476; similar to alpha-tubulin isoform 1; similar to tubulin alpha 1; T; Talpha1; Talpha1 alpha-tubulin; TBA1_DROME; Testis-specific alpha-tubulin; Tub; Tub 84B; TUB1; Tub1C; Tub84B; TUBA1; Tuba-1; tuba1 protein; TUBA1/3/4; Tuba1a; tuba1a.L; tuba1a-a; tuba1a-b; TUBA1B; TUBA1C; tuba1l; tuba1l2; TUBA2; TUBA3; TUBA3C; TUBA3D; TUBA3E; Tuba4; Tuba4a; TUBA5; Tuba6; tuba8.S; tubA84B; tubal2; Tubalpha1; tubulin; tubulin 1 alpha-chain; tubulin 1alpha; tubulin alpha; tubulin alpha 1a; tubulin alpha 1a L homeolog; tubulin alpha 1b; tubulin alpha 1c; tubulin alpha 3; tubulin alpha 3c; tubulin alpha 3e; tubulin alpha 4a; tubulin alpha 6; tubulin alpha 8 S homeolog; tubulin alpha1; tubulin alpha-1 chain; tubulin alpha1 promoter; Tubulin alpha-1A chain; tubulin alpha-1B chain; Tubulin alpha-1C chain; tubulin alpha-1C chain-like; tubulin alpha-2 chain; Tubulin alpha-3 chain; Tubulin alpha-3C chain; tubulin alpha-3C/D chain; Tubulin alpha-3D chain; Tubulin alpha-3E chain; tubulin alpha-4 chain; Tubulin alpha-4A chain; Tubulin alpha-5 chain; tubulin alpha-5 chain-like; tubulin alpha-6 chain; tubulin alpha-8 chain; tubulin alpha-ubiquitous chain; tubulin B-alpha-1; Tubulin H2-alpha; tubulin K-alpha-1; tubulin(alpha1); tubulin, alpha 1; tubulin, alpha 1 (testis specific); tubulin, alpha 1, like; tubulin, alpha 1, like 2; tubulin, alpha 1a; tubulin, alpha 1b; tubulin, alpha 1c; tubulin, alpha 2; tubulin, alpha 3c; tubulin, alpha 3e; tubulin, alpha 4; tubulin, alpha 4a; tubulin, alpha 5; tubulin, alpha 6; tubulin, alpha, brain-specific; tubulin, alpha, ubiquitous; tubulin1alpha; tubulin84B; Tubulin-alpha1; Unknown (protein for MGC:133894); unnamed protein product; wu:fb22g06; wu:fb37a10; XELAEV_18019849mg; XELAEV_18020901mg; YML085C
Gene	TUBAL3
Product Type	Antibody
Gene ID (Entrez)	10376, 112714, 22142, 22143, 22145, 22146, 238463, 291081, 291287, 300218, 316531, 347733, 500929, 64158, 7277, 7278, 73710, 7846, 79861, 84790
Formulation	PBS with 0.02% sodium azide
Immunogen	A 16 amino acid synthetic peptide near the amino terminus of human Tubulin. The immunogen is located within amino acids 140-190 of Alpha-tubulin.
Classification	Polyclonal
Primary or Secondary	Primary

440

Invitrogen™ Goat anti-Human IgG (H+L) Cross-Adsorbed Secondary Antibody

Goat Polyclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human
Host Species	Goat
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	1.78 mg/mL
Antigen	Human IgG (H+L) Cross-Adsorbed
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Product Type	Secondary Antibody
Formulation	PBS with no preservative; pH 7.6
Classification	Polyclonal
Primary or Secondary	Secondary

441

Invitrogen™ SERCA2 ATPase Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	O55143, P11507, P16615
Isotype	IgG
Concentration	500 μg/mL
Antigen	SERCA2 ATPase
Gene Symbols	Atp2a2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	9530097L16Rik; ATP2; Atp2a2; ATP2B; ATPase Ca++ transporting cardiac muscle slow twitch 2; ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2; ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2; ATPase, Ca++ transporting, cardiac muscle, slow twitch 2; ATPase, Ca++ transporting, slow twitch 2; Ca(2+)-transport ATPase class 3; calcium ATPase; calcium pump 2; calcium-ATPase (EC 3.6.1.3); calcium-transporting ATPase; calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform; cardiac Ca2+ ATPase; D5Wsu150e; DAR; DD; endoplasmic reticulum class 1/2 Ca(2+) ATPase; mKIAA4195; putative SERCA isoform; sarco(endo)plasmic reticulum Ca(2+)-dependent ATPase 2; sarco/endoplasmic reticulum Ca2+-ATPase 2; sarcoplasmic reticulum Ca2+-transport ATPase isoform; sarcoplasmic/endoplasmic reticulum calcium ATPase 2; sarcoplasmic/endoplasmic-reticulum Ca(2+) pump gene 2; SERCA; SERCA ATPase; SERCA2; Serca2a; SERCA2B; SercaII; SR Ca(2+)-ATPase 2; unnamed protein product
Gene	Atp2a2
Product Type	Antibody
Gene ID (Entrez)	11938, 29693, 488
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human SERCA2 ATPase (1-32aa MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL).
Classification	Polyclonal
Primary or Secondary	Primary

442

Invitrogen™ PSMA Monoclonal Antibody (GCP-05), Alexa Fluor™ 488

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Alexa Fluor 488
Applications	Flow Cytometry,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q04609
Isotype	IgG1
Concentration	1.0 mg/mL
Antigen	PSMA
Gene Symbols	FOLH1
Regulatory Status	RUO
Purification Method	Size-exclusion chromatography
Gene Alias	Cell growth-inhibiting gene 27 protein; FGCP; folate hydrolase (prostate-specific membrane antigen) 1; folate hydrolase 1; FOLH; Folh1; Folylpoly-gamma-glutamate carboxypeptidase; GCP2; GCPII; GIG27; glutamate carboxylase II; glutamate carboxypeptidase 2; Glutamate carboxypeptidase II; membrane glutamate carboxypeptidase; mGCP; mopsm; Naalad; NAALAD1; NAALAdase; NAALADase I; N-acetylated alpha-linked acidic dipeptidase; N-acetylated alpha-linked acidic dipeptidase 1; N-acetylated-alpha-linked acidic dipeptidase I; prostate specific membrane antigen; prostate specific membrane antigen variant F; prostate-specific membrane antigen; Prostate-specific membrane antigen homolog; PSM; PSMA; pteroylpoly-gamma-glutamate carboxypeptidase
Gene	FOLH1
Product Type	Antibody
Gene ID (Entrez)	2346
Formulation	PBS with 15mM sodium azide
Immunogen	Amino acids 44-750 of human GCPII.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	GCP-05

443

Invitrogen™ NeuN Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat,Fish
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	A6NFN3, Q8BIF2
Isotype	IgG
Concentration	1.85 mg/mL
Antigen	NeuN
Gene Symbols	RBFOX3
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	D11Bwg0517e; FLJ56884; FLJ58356; fox 1 homolog (C. elegans) 3; fox1 homolog C; Fox-1 homolog C; FOX3; FOX-3; FOX3NeuN; hexaribonucleotide binding protein 3; hexaribonucleotide binding protein 3 (HRNBP3); Hexaribonucleotide-binding protein 3; Hrnbp3; NEUN; NeuN antigen; Neuna60; neuronal nuclear antigen A60; neuronal nuclei; Neuronal nuclei antigen; RBFOX3; RFOX3; RGD1560070; RNA binding fox-1 homolog 3; RNA binding protein; RNA binding protein fox-1 homolog 3; RNA binding protein, fox-1 homolog (C. elegans) 3; RNA binding protein, fox-1 homolog 3
Gene	RBFOX3
Product Type	Antibody
Gene ID (Entrez)	146713, 287847, 52897
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Carrier-protein conjugated synthetic peptide encompassing a sequence within the N-terminus region of human NeuN. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

444

Invitrogen™ Goat anti-Human IgG Fc Recombinant Secondary Antibody, Alexa Fluor™ 488

Goat Recombinant Monoclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Goat
Conjugate	Alexa Fluor 488
Applications	Flow Cytometry,Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	1.0 mg/mL
Antigen	Human IgG Fc
Regulatory Status	RUO
Purification Method	Protein G
Product Type	Secondary Antibody
Formulation	PBS with 5mM sodium azide; pH 7.2-7.4
Immunogen	Purified Human IgG.
Classification	Recombinant Monoclonal
Primary or Secondary	Secondary
Clone	3H8L9

445

MAP2 Antibody, Novus Biologicals™

Chicken Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species	Feline,Human,Mouse,Rat
Host Species	Chicken
Conjugate	Unconjugated
Applications	Immunocytochemistry/Immunofluorescence,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),KnockDown,Proximity Ligation Assay,Western Blot
Form	Precipitation
Isotype	IgY
Gene Accession No.	P11137
Research Discipline	Cellular Markers, Cytoskeleton Markers, MAP Kinase Signaling, Neuronal Stem Cells, Neuroscience, Stem Cell Markers
Antigen	MAP2
Gene Symbols	MAP2
Regulatory Status	RUO
Purification Method	Ammonium sulfate precipitation
Dilution	Western Blot 1:10000-1:20000, Immunohistochemistry 1:1000-1:5000, Immunocytochemistry/Immunofluorescence 1:5000-1:10000, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen 1:1000-1:5000, Knockdown Validated
Molecular Weight of Antigen	199 kDa
Gene Alias	DKFZp686I2148, MAP-2, MAP2A, MAP2B, MAP2C, Microtubule Associated Protein 2, microtubule-associated protein 2, MTAP2
Gene ID (Entrez)	4133
Formulation	Supplied as concentrated IgY in PBS with 5mM Sodium Azide
Classification	Polyclonal
Immunogen	This MAP2 antibody was developed against a mix of recombinant human construct of projection domain sequences, amino acids 377-1505: Prot-r-MAP2-P1, Prot-r-MAP2-P2 and Prot-r-MAP2-P3.
Primary or Secondary	Primary
Test Specificity	This antibody was raised against recombinant constructs of the entire human projection domain, and so recognizes the high molecular MAP2 forms, MAP2A and MAP2B.

446

Invitrogen™ BNP Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P13205, P16860, P40753
Isotype	IgG
Concentration	2.8 mg/mL
Antigen	BNP
Gene Symbols	Nppb
Regulatory Status	RUO
Purification Method	Affinity Chromatography
Gene Alias	5 kDa cardiac natriuretic peptide; AA408272; Bnf; BNP; BNP(1-28); BNP(1-29); BNP(1-30); BNP(1-32); BNP(2-31); BNP(3-29); BNP(3-30); BNP(3-32); BNP(4-27); BNP(4-29); BNP(4-30); BNP(4-31); BNP(4-32); BNP(5-29); BNP(5-31); BNP(5-32); BNP-32; BNP-34; Brain natriuretic factor; brain natriuretic peptide; Brain natriuretic peptide 32; Brain natriuretic peptide 45; brain type natriuretic peptide; gamma-brain natriuretic peptide; Iso-ANP; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptide precursor type B; natriuretic peptide type B; natriuretic peptides B; natriuretic protein; Nppb; type-B natriuretic factor
Gene	Nppb
Product Type	Antibody
Gene ID (Entrez)	18158, 25105, 4879
Formulation	PBS with 50% glycerol and 0.09% sodium azide; pH 7.3
Immunogen	Synthetic peptide.
Classification	Polyclonal
Primary or Secondary	Primary

447

Invitrogen™ Goat anti-Human IgG Fc Cross-Adsorbed Secondary Antibody, DyLight™ 550

Goat Polyclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human
Host Species	Goat
Conjugate	DyLight 550
Applications	Flow Cytometry,Immunohistochemistry,Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	Human IgG Fc Cross-Adsorbed
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Product Type	Secondary Antibody
Formulation	PBS with 0.2% BSA and 0.09% sodium azide; pH 6.8 to 7.4
Immunogen	Human IgG-Fc Fragment.
Classification	Polyclonal
Primary or Secondary	Secondary

448

Invitrogen™ Oxelumab Recombinant Human Monoclonal Antibody (R4930 (Oxelumab))

Human Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Human
Conjugate	Unconjugated
Applications	Flow Cytometry,Inhibition Assays
Form	Liquid
Isotype	IgG1 κ
Concentration	1 mg/mL
Antigen	Oxelumab
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	huMAb OX40L; R4930; RG4930; RO4989991
Product Type	Antibody
Formulation	PBS with 0.02% ProClin 300
Immunogen	Oxelumab binds to human OX40L, the ligand of OX40, stimulatory receptor that is expressed on activated T cells, natural killer (NK) cells and natural killer T (NKT) cells.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	R4930 (Oxelumab)

449

Invitrogen™ CD4 Monoclonal Antibody (S3.5), APC

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Human
Host Species	Mouse
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P01730
Isotype	IgG2a
Antigen	CD4
Gene Symbols	CD4
Regulatory Status	ASR
Purification Method	Purified
Gene Alias	Activation B7-1 antigen; B7; B7.1; B7-1; BB1; B-lymphocyte activation antigen B7; CD28LG; CD28LG1; CD4; CD4 antigen; CD4 antigen (p55); CD4 antigen p55; Cd4 molecule; CD4 precursor; CD4 receptor; CD4, allele 1; cd4a; CD4mut; CD80; CD80 antigen (CD28 antigen ligand 1, B7-1 antigen); CD80 molecule; cell surface glycoprotein CD4; costimulatory factor CD80; costimulatory molecule variant IgV-CD80; CTLA-4 counter-receptor B7.1; fCD4; L3T4; LAB7; Leu-3; Ly-4; lymphocyte antigen CD4; lymphocyte antigen CD4 precursor; membrane protein; p55; T-cell differentiation antigen L3T4; T-cell surface antigen T4/Leu-3; T-cell surface glycoprotein CD4; T-cell surface glycoprotein CD4 precursor (T-cell surface antigen T4/Leu-3) (T-cell differentiation antigen L3T4); T-lymphocyte activation antigen CD80; W3/25; W3/25 antigen
Gene	CD4
Product Type	Antibody
Gene ID (Entrez)	920
Formulation	PBS with sucrose, BSA and 0.1% sodium azide
Immunogen	Human CD4.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	S3.5

450

Promotions Available

Goat IgG HRP-conjugated Antibody, R&D Systems™

Donkey Polyclonal Antibody has been used in 36 publications

Pricing & Availability

Prev
1
...
28
29
30
31
...
112,329
Next

Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ APE1 Monoclonal Antibody (13B 8E5C2) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ alpha Tubulin Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SERCA2 ATPase Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PSMA Monoclonal Antibody (GCP-05), Alexa Fluor™ 488 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NeuN Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

MAP2 Antibody, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Invitrogen™ BNP Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Oxelumab Recombinant Human Monoclonal Antibody (R4930 (Oxelumab)) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD4 Monoclonal Antibody (S3.5), APC Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Goat IgG HRP-conjugated Antibody, R&D Systems™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ APE1 Monoclonal Antibody (13B 8E5C2)

Invitrogen™ alpha Tubulin Polyclonal Antibody

Invitrogen™ SERCA2 ATPase Polyclonal Antibody

Invitrogen™ PSMA Monoclonal Antibody (GCP-05), Alexa Fluor™ 488

Invitrogen™ NeuN Polyclonal Antibody

MAP2 Antibody, Novus Biologicals™

Invitrogen™ BNP Polyclonal Antibody

Invitrogen™ Oxelumab Recombinant Human Monoclonal Antibody (R4930 (Oxelumab))

Invitrogen™ CD4 Monoclonal Antibody (S3.5), APC

Goat IgG HRP-conjugated Antibody, R&D Systems™