Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.

Search Within Results

796 – 810 of 1,746,418 results

796

Invitrogen™ BMP5 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P22003, P49003
Isotype	IgG
Concentration	500 μg/mL
Antigen	BMP5
Gene Symbols	Bmp5
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AU023399; BMP; BMP 5; Bmp5; BMP-5; bone morphogenenic protein-5; Bone morphogenetic protein; bone morphogenetic protein 5; MGC34244; se; short ear
Gene	Bmp5
Product Type	Antibody
Gene ID (Entrez)	12160, 315824, 653
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL).
Classification	Polyclonal
Primary or Secondary	Primary

797

Invitrogen™ n-Myc Monoclonal Antibody (NCM-II 100)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	P04198
Isotype	IgG1
Concentration	1 mg/mL
Antigen	n-Myc
Gene Symbols	MYCN
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	Avian myelocytomatosis viral (v-myc) related oncogene neuroblastoma derived (Nmyc); Avian myelocytomatosis viral (v-myc) related oncogene, neuroblastoma derived (Nmyc); BHLHE37; Class E basic helix-loop-helix protein 37; c-nmyc; fb57a02; MODED; Mycn; mycn protein; MYCN proto-oncogene, bHLH transcription factor; neuroblastoma MYC oncogene; neuroblastoma myc-related oncogene 1; neuroblastoma-derived v-myc avian myelocytomatosis viral related oncogene; Nmuc1; NMYC; N-myc; N-myc protein; N-myc proto-oncogene protein; Nmyc1; Nmyc-1; N-myc-like protein; ODED; oncogene NMYC; oncogene pp65/67; pp65/67; v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog; v-myc myelocytomatosis viral related oncogene, neuroblastoma derived; v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian); wu:fb57a02; zgc:85706
Gene	MYCN
Product Type	Antibody
Gene ID (Entrez)	4613
Formulation	PBS with 1mg/mL BSA, 30% glycerol and 0.05% sodium azide; pH 7.2-7.4
Immunogen	human fusion protein.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	NCM-II 100

798

Invitrogen™ CD282 (TLR2) Monoclonal Antibody (TL2.1), Functional Grade, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human
Host Species	Mouse
Conjugate	Functional Grade
Applications	Flow Cytometry,Functional Assay,Neutralization
Form	Liquid
Gene Accession No.	O60603
Isotype	IgG2a κ
Concentration	1 mg/mL
Antigen	CD282 (TLR2)
Gene Symbols	Tlr2
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CD282; Ly105; TIL4; Tlr2; TLR-2; toll like receptor 2; toll/interleukin-1 receptor-like protein 4; Toll-like receptor; toll-like receptor 2; toll-like receptor 2 variant 1; toll-like receptor 2 variant 2; toll-like-receptor 2, exon 1a_; Toll-like-receptor, exon 1b; Toll-like-receptor, exon 1b_; Toll-like-receptor2, exon 1a
Gene	Tlr2
Product Type	Antibody
Gene ID (Entrez)	7097
Formulation	PBS with no preservative; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	TL2.1

799

CD61 (Integrin beta 3) Monoclonal Antibody (VI-PL2), Super Bright™ 645, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Baboon,Canine,Cynomolgus Monkey,Human,Rhesus Macaque
Host Species	Mouse
Conjugate	Super Bright 645
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P05106
Gene Symbols	ITGB3
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene	ITGB3
Product Type	Antibody
Gene ID (Entrez)	102117791, 3690, 403788, 717379
Classification	Monoclonal
Primary or Secondary	Primary
Clone	VI-PL2

800

Invitrogen™ IL-13 Monoclonal Antibody (85BRD), PE-Cyanine7, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	PE-Cyanine7
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P35225
Isotype	IgG2b κ
Concentration	5 μL/Test
Antigen	IL-13
Gene Symbols	Il13
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	ALRH; ALRH antibody; BHR1; il 13; Il13; Il-13; IL-13; cytokine; ILN; Interleukin; interleukin 13; Interleukin13; interleukin-13; interleukin-13 precursor; L13; MGC116786; MGC116788; MGC116789; NC30; NC30 antibody; P600; P600 antibody; T-cell activation protein P600
Gene	Il13
Product Type	Antibody
Gene ID (Entrez)	3596
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	85BRD

801

Invitrogen™ FceR1 alpha Monoclonal Antibody (AER-37 (CRA1)), Super Bright™ 436, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Super Bright 436
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P12319
Isotype	IgG2b κ
Concentration	5 μL/Test
Antigen	FceR1 alpha
Gene Symbols	FCER1A
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	alpha polypeptide; fc epsilon r1; Fc epsilon receptor Ia; Fc epsilon RI alpha-chain; Fc fragment of IgE receptor Ia; Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide; Fc IgE receptor, alpha polypeptide; Fc receptor, IgE, high affinity I, alpha polypeptide; Fce1a; Fc-epsilon RI-alpha; fcepsilonri; FCER1A; FcERI; Fcr-5; high affinity immunoglobulin epsilon receptor alpha-subunit; high affinity immunoglobulin epsilon receptor subunit alpha; IgE Fc receptor subunit alpha; Iger01; immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide; RATIGER01; RP11-550P17.3
Gene	FCER1A
Product Type	Antibody
Gene ID (Entrez)	2205
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	AER-37 (CRA1)

802

mCherry Recombinant Rat Monoclonal Antibody (16D7), Alexa Fluor™ Plus 647, Invitrogen™

Rat Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Chemical
Host Species	Rat
Conjugate	Alexa Fluor Plus 647
Applications	Flow Cytometry,Western Blot
Form	Liquid
Isotype	IgG2a κ
Concentration	1.0 mg/mL
Antigen	mCherry
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	mCherry
Product Type	Antibody
Formulation	Proprietary buffer with 0.008% Bromonitrodioxane, 0.008% Methylisothiazolone; pH 6.8
Immunogen	Full-length protein mCherry.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	16D7

803

CD58 (LFA-3) Monoclonal Antibody (TS2/9), PerCP-eFluor™ 710, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	PerCP-eFluor 710
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P19256
Concentration	5 μL/Test
Antigen	CD58 (LFA-3)
Gene Symbols	CD58
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Ag3; CD305; CD58; CD58 antigen; CD58 antigen, (lymphocyte function-associated antigen 3); CD58 molecule; FLJ23181; FLJ43722; LAIR1; LAIR-1; LFA3; LFA-3; Lymphocyte function-associated antigen 3; membrane receptor; RP5-1086K13.2; surface glycoprotein LFA-3
Gene	CD58
Product Type	Antibody
Gene ID (Entrez)	965
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	TS2/9

804

Invitrogen™ Neurocan Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	O14594, P55066, P55067
Isotype	IgG
Concentration	500 μg/mL
Antigen	Neurocan
Gene Symbols	Ncan
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	245 kDa early postnatal core glycoprotein; C230035B04; Chondroitin sulfate proteoglycan 3; chondroitin sulfate proteoglycan 3 (neurocan); chondroitin sulfate proteoglycan 3, related sequence; Cspg3; Cspg3-rs; NCAN; NEUR; neurocan; neurocan core protein; neurocan proteoglycan; TGFbeta-induced transcript, brain; Tgfbit
Gene	Ncan
Product Type	Antibody
Gene ID (Entrez)	13004, 1463, 58982
Formulation	PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence of human Neurocan (HENTWIGLNDRIVERDFQWTDNTGLQFENWRENQPDNFFA).
Classification	Polyclonal
Primary or Secondary	Primary

805

PCNA Monoclonal Antibody (PC10 (3F81)), eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P04961, P12004, P17918
Concentration	0.5 mg/mL
Antigen	PCNA
Gene Symbols	Pcna
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	ATLD2; cb16; Cyclin; DNA polymerase delta auxiliary protein; etID36690.10; fa28e03; fb36g03; HGCN8729; hypothetical protein LOC515499; MGC8367; Pcna; pcna protein; Pcna/cyclin; PCNAR; POL30; Proliferating cell nuclear antigen; wu:fa28e03; wu:fb36g03; YBR0811; YBR088C
Gene	Pcna
Product Type	Antibody
Gene ID (Entrez)	18538, 25737, 5111
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	PC10 (3F81)

806

Invitrogen™ CD56 (NCAM) Recombinant Mouse Monoclonal Antibody (TULY56), Alexa Fluor™ Plus 555

Mouse Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Alexa Fluor Plus 555
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P13591
Isotype	IgG1 κ
Concentration	1 mg/mL
Antigen	CD56 (NCAM)
Gene Symbols	Ncam1
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	adhesion molecule; antigen recognized by monoclonal antibody 5.1H11; Cd56; CD-56; CD56 120 kDa GPI-linked isoform; CD56 140 kDa isoform; CD56 140 kDa VASE isoform; E NCAM; E-NCAM; MSK39; N CAM1; NCAM; N-CAM; Ncam1; N-CAM-1; NCAM-1; NCAMC; NCAM-C; neural cell adhesion molecule; Neural cell adhesion molecule 1; neural cell adhesion molecule, NCAM; sCD56; sNCAM; soluble CD56; soluble NCAM
Gene	Ncam1
Product Type	Antibody
Gene ID (Entrez)	4684
Formulation	Proprietary buffer with 0.008% Bromonitrodioxane, 0.008% Methylisothiazolone; pH 6.3-7.3
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	TULY56

807

CD11b Monoclonal Antibody (ICRF44), Brilliant Violet™ 605, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Baboon,Chimpanzee,Cynomolgus Monkey,Human,Rhesus Macaque
Host Species	Mouse
Conjugate	Brilliant Violet 605
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P11215
Concentration	5 μL/Test
Antigen	CD11b
Gene Symbols	ITGAM
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	antigen CD11b (p170); antigen CD11b (p170); macrophage antigen alpha polypeptide; CD11 antigen-like family member B; CD11b; CD11B (p170); CD11b/CD18; cell surface glycoprotein MAC-1 alpha subunit; cell surface glycoprotein MAC-1 subunit alpha; complement component 3 receptor 3 subunit; complement component receptor 3 alpha-a; complement receptor type 3; CR3; CR-3 alpha chain; CR3A; F730045J24Rik; integrin alpha M; integrin alpha-M; integrin subunit alpha M; integrin, alpha M; integrin, alpha M (complement component 3 receptor 3 subunit); ITGAM; Leukocyte adhesion receptor MO1; leukocyte integrin alpha-M chain; LOC100351865; Ly-40; MAC1; Mac-1; Mac-1 alpha; Mac-1 alpha (Mac1A); MAC-1 alpha subunit; MAC1A; Mac-1a; macrophage antigen alpha; macrophage antigen alpha polypeptide; MGC117044; MO1A; Neutrophil adherence receptor; neutrophil adherence receptor alpha-M subunit; SLEB6; unnamed protein product
Gene	ITGAM
Gene ID (Entrez)	101866035, 3684, 454069, 714832
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	ICRF44

808

IL-33R (ST2) Monoclonal Antibody (RMST2-33), PE, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2b κ
Gene Accession No.	P14719
Concentration	0.2 mg/mL
Antigen	IL-33R (ST2)
Gene Symbols	IL1RL1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	DER4; Fit1; Fit-1; Fos-responsive gene 1 protein; growth stimulation-expressed; homolog of mouse growth stimulation-expressed; IL-1 R4; IL1RL1; IL-1RL1; IL33R; IL-33R; interleukin 1 receptor like 1; interleukin 1 receptor-like 1; interleukin 1 receptor-related protein; Interleukin1 receptor like 1; interleukin-1 receptor-like 1; Interleukin-33 receptor alpha chain; Ly84; lymphocyte antigen 84; Protein ST2; Protein T1; sIL 33R; soluble IL 33 Receptor; soluble IL 33R; St2; ST2L; St2-rs1; ST2V; Ste2; T1; T1/ST2
Gene	IL1RL1
Product Type	Antibody
Gene ID (Entrez)	17082
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	RMST2-33

809

Invitrogen™ Phospho-NFkB p65 (Ser529) Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	Q04206, Q04207
Isotype	IgG
Antigen	Phospho-NFkB p65 (Ser529)
Gene Symbols	RELA
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	avian reticuloendotheliosis viral (v-rel) oncogene homolog A; EBP-1; I79_021812; MGC131774; NF KB; NFkappaB p65; nf-kappa-b p65; NF-kappa-B p65delta3; NF-kappa-B transcription factor p65; NF-kappaB transcription factor p65 subunit; NFkB; NF-kB p65; NF-kB p65 subunit; nfkb rela; NFKB1; nfkb3; NFkB-p50; nuclear factor; nuclear factor kappa b; nuclear factor kappa B subunit p65; nuclear factor NF-kappa-B p65 subunit; Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3; p65; p65 NF kappaB; p65 NF-kappa B; p65 NFkB; P65 transcription factor; putative transcription factor p65 homolog; REL A; rel1; rela; RELA proto-oncogene, NF-kB subunit; rela.L; rela-a; Transcription factor p65; v-rel avian reticuloendotheliosis viral oncogene homolog A; v-rel avian reticuloendotheliosis viral oncogene homolog A L homeolog; v-rel reticuloendotheliosis viral oncogene homolog A; v-rel reticuloendotheliosis viral oncogene homolog A (avian); v-rel reticuloendotheliosis viral oncogene homolog A, nuclear factor of kappa light polypeptide gene enhancer in B-cells 3, p65; XELAEV_18022301mg; Xrel1; xrela
Gene	RELA
Product Type	Antibody
Gene ID (Entrez)	19697, 5970
Formulation	Dulbecco's PBS with 1mg/mL BSA and 0.05% sodium azide; pH 7.3
Immunogen	The antiserum was produced against a chemically synthesized phosphopeptide derived from a region of human NFkB that contains serine 529.
Classification	Polyclonal
Primary or Secondary	Primary

810

Invitrogen™ COX1 Recombinant Rabbit Monoclonal Antibody (SC68-05)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry,Western Blot
Form	Liquid
Gene Accession No.	P22437, P23219, Q63921
Isotype	IgG
Concentration	1 mg/mL
Antigen	COX1
Gene Symbols	COX1, PTGS1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	COI; COX1; Cox-1; COX3; Cox-3; COXI; cyclooxygenase 3; cyclooxygenase precursor (EC 1.14.99.1); cyclooxygenase-1; Cytochrome c oxidase polypeptide I; Cytochrome c oxidase subunit 1; cytochrome c oxidase subunit I; mitochondrially encoded cytochrome c oxidase I; Mtco1; mt-Co1; P PGG/HS; PCOX1; PES-1; PGG/HS; PGH synthase 1; PGHS1; Pghs-1; PHS 1; PHS1; prostaglandin endoperoxide synthase; prostaglandin G/H synthase 1; prostaglandin G/H synthase and cyclooxygenase; prostaglandin G/H synthase precursor (EC 1.14.99.1); prostaglandin H2 synthase 1; Prostaglandin-endoperoxide synthase 1; prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase); PTGHS; PTGS1; unnamed protein product
Gene	PTGS1
Product Type	Antibody
Gene ID (Entrez)	19224, 24693, 4512, 5742
Formulation	TBS with 0.05% BSA, 40% Glycerol and 0.05% sodium azide; pH 7.4
Immunogen	Synthetic peptide within Human COX1 aa 116-159.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	SC68-05

Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ BMP5 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ n-Myc Monoclonal Antibody (NCM-II 100) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD282 (TLR2) Monoclonal Antibody (TL2.1), Functional Grade, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD61 (Integrin beta 3) Monoclonal Antibody (VI-PL2), Super Bright™ 645, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ IL-13 Monoclonal Antibody (85BRD), PE-Cyanine7, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ FceR1 alpha Monoclonal Antibody (AER-37 (CRA1)), Super Bright™ 436, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD58 (LFA-3) Monoclonal Antibody (TS2/9), PerCP-eFluor™ 710, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Neurocan Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

PCNA Monoclonal Antibody (PC10 (3F81)), eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD11b Monoclonal Antibody (ICRF44), Brilliant Violet™ 605, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

IL-33R (ST2) Monoclonal Antibody (RMST2-33), PE, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Phospho-NFkB p65 (Ser529) Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ COX1 Recombinant Rabbit Monoclonal Antibody (SC68-05) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ BMP5 Polyclonal Antibody

Invitrogen™ n-Myc Monoclonal Antibody (NCM-II 100)

Invitrogen™ CD282 (TLR2) Monoclonal Antibody (TL2.1), Functional Grade, eBioscience™

CD61 (Integrin beta 3) Monoclonal Antibody (VI-PL2), Super Bright™ 645, eBioscience™, Invitrogen™

Invitrogen™ IL-13 Monoclonal Antibody (85BRD), PE-Cyanine7, eBioscience™

Invitrogen™ FceR1 alpha Monoclonal Antibody (AER-37 (CRA1)), Super Bright™ 436, eBioscience™

CD58 (LFA-3) Monoclonal Antibody (TS2/9), PerCP-eFluor™ 710, eBioscience™, Invitrogen™

Invitrogen™ Neurocan Polyclonal Antibody

PCNA Monoclonal Antibody (PC10 (3F81)), eBioscience™, Invitrogen™

CD11b Monoclonal Antibody (ICRF44), Brilliant Violet™ 605, eBioscience™, Invitrogen™

IL-33R (ST2) Monoclonal Antibody (RMST2-33), PE, eBioscience™, Invitrogen™

Invitrogen™ Phospho-NFkB p65 (Ser529) Polyclonal Antibody

Invitrogen™ COX1 Recombinant Rabbit Monoclonal Antibody (SC68-05)