Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.

Search Within Results

796 – 810 of 1,659,610 results

796

Invitrogen™ Goat anti-Rabbit IgG (H+L) Secondary Antibody, Biotin

Goat Polyclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. Glycerol (1:1) may be added for added stability.
Target Species	Rabbit
Host Species	Goat
Conjugate	Biotin
Applications	ELISA,Immunohistochemistry,In Situ Hybridization (ISH),Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	1.5 mg/mL
Antigen	Rabbit IgG (H+L)
Regulatory Status	RUO
Purification Method	Affinity chromatography
Product Type	Secondary Antibody
Formulation	PBS with 3mg/mL BSA and 0.08% sodium azide; pH 7.8
Classification	Polyclonal
Primary or Secondary	Secondary

797

Invitrogen™ LAMP-2A Polyclonal Antibody (AMC2)

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Inhibition Assays,Western Blot
Form	Liquid
Gene Accession No.	P17046, P17047
Isotype	IgG
Concentration	0.25 mg/mL
Antigen	LAMP-2A
Gene Symbols	LAMP2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	CD107 antigen-like family member B; CD107b; EGK_20887; Igp96; Lamp II; LAMP2; LAMP-2; LAMP-2 Isoform 2A; LAMP-2 Variant A; Lamp-2a; Lamp-2b; Lamp-2c; LAMPB; LGP110; LGP-110; LGP-96; LGP-B; lysosomal associated membrane protein 2; lysosomal membrane glycoprotein 2; lysosomal membrane glycoprotein type B; lysosomal-associated membrane protein 2; lysosome-associated membrane glycoprotein 2; lysosome-associated membrane protein 2; Mac3; RP23-193O17.2
Gene	LAMP2
Product Type	Antibody
Gene ID (Entrez)	16784, 24944
Formulation	PBS with 0.1% sodium azide; pH 7.4
Immunogen	A synthetic peptide of the cytosolic tail of rat LAMP-2A (GLKRHHTGYEQF).
Classification	Polyclonal
Primary or Secondary	Primary
Clone	AMC2

798

Invitrogen™ alpha Actinin 2 Recombinant Rabbit Monoclonal Antibody (7H1L69)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P35609, Q9JI91
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	alpha Actinin 2
Gene Symbols	Actn2
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	1110008F24Rik; actinin alpha 2; actinin, alpha 2; ACTN2; alpha-actinin skeletal muscle; Alpha-actinin skeletal muscle isoform 2; Alpha-actinin-2; CMD1AA; CMH23; F-actin cross-linking protein
Gene	Actn2
Product Type	Antibody
Gene ID (Entrez)	11472, 291245, 88
Formulation	PBS with 0.09% sodium azide; pH 7.4
Immunogen	Peptides corresponding to human Sarcomeric alpha actinin/alpha actinin 2 [1) aa834-aa852, 2) aa5-aa24].
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	7H1L69

799

Invitrogen™ Phospho-Rb (Ser807, Ser811) Recombinant Rabbit Monoclonal Antibody (13H27L9)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P06400
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	Phospho-Rb (Ser807, Ser811)
Gene Symbols	RB1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	Cleaved Rb; delta RB-p70; DRb-p70; exon 17 tumor GOS561 substitution mutation causes premature stop; GOS563 exon 17 substitution mutation causes premature stop; OSRC; p104; p104 chicken Rb; P105RB; p105-Rb; Phospho-Retinoblastoma; pp105; pp110; PPP1R130; pRb; prepro-retinoblastoma-associated protein; protein phosphatase 1, regulatory subunit 130; rb; RB transcriptional corepressor 1; RB1; Rb-1; Rb-p70; Retin; Retinoblastoma; retinoblastoma 1; retinoblastoma 1 (including osteosarcoma); retinoblastoma 1 protein; retinoblastoma gene; retinoblastoma isoform A; retinoblastoma protein; retinoblastoma suspectibility protein; retinoblastoma tumor suppressor; retinoblastoma-associated protein
Gene	RB1
Product Type	Antibody
Gene ID (Entrez)	5925
Formulation	PBS with 0.09% sodium azide; pH 7.4
Immunogen	Peptide corresponding to human Phospho-Rb (Ser807/Ser811) [aa805-aa814].
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	13H27L9

800

Invitrogen™ P2Y12 Recombinant Rabbit Monoclonal Antibody (4H5L19)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q9CPV9, Q9EPX4, Q9H244
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	P2Y12
Gene Symbols	P2ry12
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	2900079B22Rik; 4921504D23Rik; ADP-glucose receptor; ADPG-R; BDPLT8; Gi-coupled ADP receptor HORK3; G-protein coupled receptor SP1999; HORK3; P2RY12; P2T(AC); P2Y purinoceptor 12; P2Y(12)R; P2Y(AC); P2Y(ADP); P2Y(cyc); P2y12; P2Y12 platelet ADP receptor; P2YR12; purinergic receptor P2RY12; purinergic receptor P2Y, G-protein coupled 12; purinergic receptor P2Y, G-protein coupled, 12; purinergic receptor P2Y12; putative G-protein coupled receptor; SP1999
Gene	P2ry12
Product Type	Antibody
Gene ID (Entrez)	64803, 64805, 70839
Formulation	PBS with 0.09% sodium azide; pH 7.4
Immunogen	Peptides corresponding to human P2Y12 [1) aa323-aa342, 2) aa119-aa138].
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	4H5L19

801

Invitrogen™ PDGFRA Recombinant Superclonal™ Antibody

Rabbit Recombinant Superclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ChIP Assay,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P16234
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	PDGFRA
Gene Symbols	PDGFRA
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	AI115593; alpha platelet-derived growth factor receptor; Alpha platelet-derived growth factor receptor precursor (PDGF-R-alpha); alpha-type platelet-derived growth factor receptor; APDGFR; CD140 antigen-like family member A; CD140A; CD140a antigen; GAS9; MGC74795; OTTHUMP00000218656; PDGF A-chain; PDGF alpha chain; PDGF Receptor alpha; PDGF subunit A; PDGF-1; PDGFACE; PDGFR2; Pdgfr-2; PDGFRA; pdgfr-a; PDGFRA/BCR fusion; PDGF-R-alpha; PDGFR-alpha; platelet derived growth factor receptor alpha; platelet derived growth factor receptor, alpha polypeptide; platelet-derived growth factor alpha receptor; Platelet-derived growth factor receptor 2; platelet-derived growth factor receptor alpha; platelet-derived growth factor receptor, alpha polypeptide; rearranged-in-hypereosinophilia-platelet derived growth factor receptor alpha fusion protein; RHEPDGFRA
Gene	PDGFRA
Product Type	Antibody
Gene ID (Entrez)	5156
Formulation	PBS with 0.09% sodium azide
Immunogen	Recombinant protein corresponding to amino acids 259-436 of human platelet-derived growth factor receptor - alpha chain.
Classification	Recombinant Superclonal
Primary or Secondary	Primary

802

Invitrogen™ CCL5 (RANTES) Recombinant Superclonal™ Antibody (25HCLC)

Rabbit Recombinant Superclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P13501, P30882, P50231
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	CCL5 (RANTES)
Gene Symbols	CCL5
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	beta-chemokine RANTES; CC chemokine; C-C motif chemokine 5; C-C motif chemokine ligand 5; CCL5; chemokine (C-C motif) ligand 5; D17S136E; EoCP; eosinophil chemotactic cytokine; MGC17164; MuRantes; OTTHUMP00000197106; RANTES; RANTES protein; RANTES(3-68); RANTES(4-68); regulated upon activation normal T-cell expressed and secreted; regulated upon activation, normally T-expressed, and presumably secreted; Scya5; SIS δ; SISd; SIS-delta; SISδ; small inducible cytokine A5; small inducible cytokine subfamily A (Cys-Cys), member 5; small-inducible cytokine A5; T cell-specific protein P228; T-cell specific protein p288; T-cell-specific protein RANTES; TCP228; Unknown (protein for MGC:127014)
Gene	CCL5
Product Type	Antibody
Gene ID (Entrez)	20304, 6352, 81780
Formulation	PBS with 0.09% sodium azide
Immunogen	proprietary.
Classification	Recombinant Superclonal
Primary or Secondary	Primary
Clone	25HCLC

803

Invitrogen™ STAT6 Recombinant Rabbit Monoclonal Antibody (21HCLC)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ChIP Assay,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P42226, P52633
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	STAT6
Gene Symbols	STAT6
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	12S1644; D12S1644; IL4 STAT; IL-4 Stat; IL-4-STAT; signal transducer and activator of transcription 6; signal transducer and activator of transcription 6, interleukin-4 induced; signal transducer and transcription activator 6; STAT; STAT, interleukin4-induced; Stat6; STAT-6; STAT6B; STAT6C; transcription factor IL-4 STAT
Gene	STAT6
Product Type	Antibody
Gene ID (Entrez)	20852, 6778
Formulation	PBS with 0.09% sodium azide
Immunogen	Peptide corresponding to amino acids 630-638 of human singal transducer and activator of transcription 6.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	21HCLC

804

anti-Rabbit IgG, peroxidase-linked species-specific whole antibody (from donkey) Secondary Antibody, Cytiva

A highly species-specific anti-Rabbit IgG. Cytiva Lifescience™ anti-Rabbit IgG, peroxidase-linked species-specific whole antibody (from donkey) Secondary Antibody is used with Amersham™ ECL Western Blotting detection reagents.

Pricing & Availability
Specifications

Antigen	IgG
Purification Method	Affinity Purified
Host Species	Donkey
Conjugate	HRP
Classification	Monoclonal
Isotype	IgG
Primary or Secondary	Secondary

805

Invitrogen™ Nrf2 Recombinant Rabbit Monoclonal Antibody (HL1021)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Proximity Ligation Assay,Immunocytochemistry
Form	Liquid
Gene Accession No.	O54968, Q16236, Q60795
Isotype	IgG
Concentration	1 mg/mL
Antigen	Nrf2
Gene Symbols	NFE2L2
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	AI194320; E4TF1-60; E4TF1A; HEBP1; Nfe2l2; NF-E2-related factor 2; NFE2-related factor 2; NF-E2-related factor-2; NFT2; NRF2; NRF2A; nuclear factor (erythroid-derived 2)-like 2; nuclear factor erythroid 2-like 2; nuclear factor erythroid 2-related factor 2; nuclear factor erythroid-derived 2-like 2; nuclear factor, erythroid 2 like 2; nuclear factor, erythroid 2-like 2; nuclear factor, erythroid derived 2, like 2; Unknown (protein for IMAGE:7945830)
Gene	NFE2L2
Product Type	Antibody
Gene ID (Entrez)	18024, 4780, 83619
Formulation	PBS with no preservative
Immunogen	Recombinant protein encompassing a sequence within the center region of human NRF2. The exact sequence is proprietary.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	HL1021

806

Invitrogen™ CD79a Monoclonal Antibody (HM57)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, do not freeze
Target Species	Human,Mouse,Rat,Rabbit,Bovine,Pig,Horse,Chicken,Guinea Pig,Marsupial
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P11911, P11912, P40293
Isotype	IgG1
Concentration	1 mg/mL
Antigen	CD79a
Gene Symbols	CD79A
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	B-cell antigen receptor; B-cell antigen receptor complex-associated protein alpha chain; B-cell antigen receptor complex-associated protein alpha chain-like; CD79; CD79a; CD79A antigen (immunoglobulin-associated alpha); CD79a molecule; CD79a molecule, immunoglobulin-associated alpha; CD79A protein; CD79-alpha protein; EGK_10665; Ig alpha; IGA; Igalpha; ig-alpha; immunoglobulin-associated alpha; LOC100913063; Ly54; Ly-54; MB1; MB-1; MB-1 membrane glycoprotein; Membrane-bound immunoglobulin-associated protein; surface IgM-associated protein
Gene	CD79A
Product Type	Antibody
Gene ID (Entrez)	100052219, 100190992, 100724815, 100913063, 12518, 281674, 973
Formulation	PBS with 15mM sodium azide; pH 7.4
Immunogen	Synthetic peptide corresponding to amino acids 202-216 of human CD79a.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	HM57

807

Invitrogen™ DRD2 Recombinant Rabbit Monoclonal Antibody (HL1478)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P14416, P61168, P61169
Isotype	IgG
Concentration	1 mg/mL
Antigen	DRD2
Gene Symbols	DRD2
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	D(2) dopamine receptor; D2 receptor; D2DR; D2R; Dopamine 2 receptor; Dopamine D2 receptor; dopamine receptor 2; dopamine receptor D2; dopamine receptor D2 isoform; Drd2; Drd-2; seven transmembrane helix receptor
Gene	DRD2
Product Type	Antibody
Gene ID (Entrez)	13489, 1813, 24318
Formulation	PBS with no preservative
Immunogen	Recombinant protein encompassing a sequence within the N-term region of Human Dopamine Receptor D2. The exact sequence is proprietary.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	HL1478

808

Invitrogen™ IL-1 beta Recombinant Rabbit Monoclonal Antibody (HL1421)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P01584, P10749, Q63264
Isotype	IgG
Concentration	1 mg/mL
Antigen	IL-1 beta
Gene Symbols	IL1B
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	catabolin; cytokine; Hematopoietin 1 (H1); IFN beta inducing factor; il 1b; IL 1β; IL-1; IL1 B; IL-1 beta; IL-1 precursor; IL1B; IL-1B; IL1B1; IL1beta; IL-1beta; IL1-BETA; IL1F2; IL1β; ILN; Interleukin; interleukin 1 beta; Interleukin 1 beta precursor; interleukin 1, beta; interleukin 1, beta 1; interleukin 1-beta; interleukin1beta; Interleukin1 beta; interleukin-1 beta; interleukin-1 beta precursor; interleukin-1 beta precursor (AA -113 to 153); interleukin-1 beta proprotein; interleukin-1b; interleukin-1beta; interleukin-beta; LAF; lymphocyte proliferation-potentiating factor; Osteoclast activating factor (OAF); preinterleukin 1 beta; Pro interleukin 1 beta; prointerleukin-1 beta; pro-interleukin-1-beta
Gene	IL1B
Product Type	Antibody
Gene ID (Entrez)	16176, 24494, 3553
Formulation	PBS with no preservative
Immunogen	Recombinant protein encompassing a sequence within the center region of human IL1 beta. The exact sequence is proprietary.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	HL1421

809

Invitrogen™ RAGE Monoclonal Antibody (5C6C1)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	Q15109, Q62151, Q63495
Isotype	IgG2b
Concentration	500 μg/mL
Antigen	RAGE
Gene Symbols	AGER
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	advanced glycation end product receptor; advanced glycation end-product receptor; advanced glycation end-products receptor; advanced glycosylation end product-specific receptor; advanced glycosylation end product-specific receptor variant 2; advanced glycosylation end product-specific receptor variant 3; advanced glycosylation end product-specific receptor variant 4; advanced glycosylation end product-specific receptor variant 5; advanced glycosylation end-product specific receptor; Ager; MAPK/MAK/MRK overlapping kinase; MOK; MOK protein kinase; RAGE; RAGE isoform NtRAGE-delta; RAGE isoform sRAGE-delta; RAGE/AGER; RAGE1; RAGE-1; RAGE-4 ORF3; receptor for advanced glycation endproducts; receptor for advanced glycation end-products variant 20; receptor for advanced glycosylation end products; receptor of advanced glycosylation end products of proteins; immunoglobulin superfamily; MHC class II; MHC class III; renal cell carcinoma antigen; renal tumor antigen 1; SCARJ1; sRAGE; STK30
Gene	AGER
Product Type	Antibody
Gene ID (Entrez)	11596, 177, 81722
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI).
Classification	Monoclonal
Primary or Secondary	Primary
Clone	5C6C1

810

Invitrogen™ NTSR1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P30989
Isotype	IgG
Concentration	Conc. Not Determined
Antigen	NTSR1
Gene Symbols	NTSR1
Regulatory Status	RUO
Gene Alias	bK445C9.6; FLJ22086; High-affinity levocabastine-insensitive neurotensin receptor; hNtr1; neurotensin receptor 1; neurotensin receptor 1 (high affinity); neurotensin receptor type 1; NT receptor-1; NT1 receptor; NT-1r; NTR; NTR1; NT-R-1; NTR-1; NTRH; NTRR; NTS1; NTS-1; Ntsr; Ntsr1; RNTR1; Spp382; TIP39
Gene	NTSR1
Product Type	Antibody
Gene ID (Entrez)	4923
Formulation	Whole serum with 0.02% sodium azide
Immunogen	Synthetic peptide corresponding to the C-terminal amino acids K(398)ADSVSSNHTLSSNATRETLY(418) of NTSR1.
Classification	Polyclonal
Primary or Secondary	Primary

Prev
1
...
52
53
54
55
...
110,641
Next

Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ LAMP-2A Polyclonal Antibody (AMC2) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

anti-Rabbit IgG, peroxidase-linked species-specific whole antibody (from donkey) Secondary Antibody, Cytiva GSA/VA ContractAvailable on GSA/VA contract for Federal Government customers.Learn More

Invitrogen™ Nrf2 Recombinant Rabbit Monoclonal Antibody (HL1021) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD79a Monoclonal Antibody (HM57) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ DRD2 Recombinant Rabbit Monoclonal Antibody (HL1478) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ IL-1 beta Recombinant Rabbit Monoclonal Antibody (HL1421) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ RAGE Monoclonal Antibody (5C6C1) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NTSR1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ LAMP-2A Polyclonal Antibody (AMC2)

anti-Rabbit IgG, peroxidase-linked species-specific whole antibody (from donkey) Secondary Antibody, Cytiva

Invitrogen™ Nrf2 Recombinant Rabbit Monoclonal Antibody (HL1021)

Invitrogen™ CD79a Monoclonal Antibody (HM57)

Invitrogen™ DRD2 Recombinant Rabbit Monoclonal Antibody (HL1478)

Invitrogen™ IL-1 beta Recombinant Rabbit Monoclonal Antibody (HL1421)

Invitrogen™ RAGE Monoclonal Antibody (5C6C1)

Invitrogen™ NTSR1 Polyclonal Antibody