Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.

Search Within Results

811 – 825 of 1,659,610 results

811

Invitrogen™ C/EBP alpha Monoclonal Antibody (15C8)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunoprecipitation,Western Blot
Form	Liquid
Gene Accession No.	P05554, P49715, P53566
Isotype	IgG1
Concentration	1 mg/mL
Antigen	C/EBP alpha
Gene Symbols	CEBPA
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	C EBP; C/EBP; c/EBP alpha; C/EBPa; C/ebpalpha; C/EBP-alpha; CAAT/enhancer-binding protein DNA-binding protein; CAAT/enhancer-binding protein, DNA-binding protein; CBF-A; CCAAT enhancer binding protein alpha; CCAAT/enhancer binding protein (C/EBP), alpha; CCAAT/enhancer binding protein alpha; CCAAT/enhancer binding protein, alpha; CCAAT/enhancer-binding protein alpha; Cebp; Cebpa; DBPCEP; OTTHUMP00000220269
Gene	CEBPA
Product Type	Antibody
Gene ID (Entrez)	1050, 12606, 24252
Formulation	PBS with 1 mg/mL BSA and 0.05% sodium azide
Immunogen	Synthetic peptide corresponding to residues M(1) E S A D F Y E V E P R P P(14) of mouse C/EBP alpha.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	15C8

812

Apolipoprotein E/ApoE Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing & Availability

813

Invitrogen™ COL1A1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	P02452, P02454, P11087
Isotype	IgG
Concentration	500 μg/mL
Antigen	COL1A1
Gene Symbols	COL1A1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	alpha-1 type 1 collagen; alpha-1 type I collagen; alpha1(I) procollagen; COL1A; Col1a1; Col1a-1; Cola1; Cola-1; COLIA1; Collagen 1; collagen alpha 1 chain type I; collagen alpha-1(I) chain; collagen alpha-1(I) chain preproprotein; Collagen I; collagen of skin, tendon and bone, alpha-1 chain; collagen type I alpha 1; collagen, type 1, alpha 1; collagen, type I, alpha 1; Collagen1A1; EDSC; Mov13; Mov-13; OI1; OI2; OI3; OI4; pro-alpha-1 collagen type 1; procollagen type I, alpha 1; procollagen, type 1, alpha 1; procollagen, type I, alpha 1; Type I Collagen; type I proalpha 1; type I procollagen alpha 1 chain; type I-alpha 1 collagen
Gene	COL1A1
Product Type	Antibody
Gene ID (Entrez)	1277, 12842, 29393
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of mouse Collagen I (1192-1207aa QPPQEKSQDGGRYYRA).
Classification	Polyclonal
Primary or Secondary	Primary

814

Invitrogen™ EphB1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P09759, P54762, Q8CBF3
Isotype	IgG
Concentration	500 μg/mL
Antigen	EphB1
Gene Symbols	EPHB1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	9330129L11; AW488255; C130099E04Rik; Cek6; EK6; ELK; Elkh; ELK-related protein tyrosine kinase; ENSMUSG00000074119; Eph receptor B1; Eph receptor B2 (ELK-related protein tyrosine kinase); eph tyrosine kinase 2; EPHB1; Ephb2; EPH-like kinase 6; Ephrin type-B receptor 1; EPHT2; Epth2; Erk; Hek6; NET; Neuronally-expressed EPH-related tyrosine kinase; soluble EPHB1 variant 1; tyrosine-protein kinase receptor EPH-2
Gene	EPHB1
Product Type	Antibody
Gene ID (Entrez)	2047, 24338, 270190
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human Eph receptor B1 (56-88aa RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE).
Classification	Polyclonal
Primary or Secondary	Primary

815

Invitrogen™ TRAC Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P01848
Isotype	IgG
Concentration	500 μg/mL
Antigen	TRAC
Gene Symbols	TRAC
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	IMD7; T-cell receptor; T-cell receptor alpha constant; TCRA; TRA; TRAC; TRCA
Gene	TRAC
Product Type	Antibody
Gene ID (Entrez)	100101484, 28755
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	E. coli-derived human TCR alpha recombinant protein (Position: I1-L114).
Classification	Polyclonal
Primary or Secondary	Primary

816

Invitrogen™ NRG1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry,Western Blot
Form	Lyophilized
Gene Accession No.	P43322, Q02297
Isotype	IgG
Concentration	500 μg/mL
Antigen	NRG1
Gene Symbols	NRG1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	6030402G23Rik; Acetylcholine receptor-inducing activity; ARIA; Breast cancer cell differentiation factor p45; D230005F13Rik; GGF; GGF2; GGFII; Glial growth factor; glial growth factor 2; heregulin; heregulin, alpha (45kD, ERBB2 p185-activator); HGL; HRG; HRG1; HRGA; HRGalpha; MST131; MSTP131; NDF; Neu differentiation factor; neuregulin 1; neuregulin 1 type III beta 3; Neuregulin-1; NRG1; NRG-1; NRG1-IT2; pro-neuregulin-1, membrane-bound isoform; Pro-NRG1; sensory and motor neuron derived factor; Sensory and motor neuron-derived factor; SMDF; type I neuregulin 1; type III neuregulin 1
Gene	NRG1
Product Type	Antibody
Gene ID (Entrez)	112400, 211323, 3084
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human NRG1 (617-636aa RFSTQEEIQARLSSVIANQD).
Classification	Polyclonal
Primary or Secondary	Primary

817

Invitrogen™ Osteocalcin Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P02818, P04640, P86546
Isotype	IgG
Concentration	2.6 mg/mL
Antigen	Osteocalcin
Gene Symbols	BGLAP
Regulatory Status	RUO
Purification Method	Affinity Chromatography
Gene Alias	Bglap; Bglap1; Bglap2; BGP; Bgpr; Bgpra; bone gamma carboxyglutamate protein; bone gamma carboxyglutamate protein 1; bone gamma-carboxyglutamate (gla) protein; bone gamma-carboxyglutamate (gla) protein (osteocalcin); bone gamma-carboxyglutamate protein; bone gamma-carboxyglutamate protein 2; bone gamma-carboxyglutamate protein osteocalcin; bone gamma-carboxyglutamate; BGLAP; bone gamma-carboxyglutamic acid (Gla) protein (osteocalcin); bone Gla protein; bone gla protein BGP; bone Gla-protein; gamma-carbooxyglutamate (gla) protein; Gamma-carboxyglutamic acid-containing protein; GLA; Gla protein precusor; mOC-A; OC; OCN; OG1; Osteocalcin; PMF1; RP11-54H19.5; unnamed protein product
Gene	BGLAP
Product Type	Antibody
Gene ID (Entrez)	12096, 25295, 632
Formulation	PBS with 50% glycerol and 0.09% sodium azide; pH 7.3
Immunogen	Synthetic peptide.
Classification	Polyclonal
Primary or Secondary	Primary

818

Invitrogen™ Aquaporin 5 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P47864, P55064, Q9WTY4
Isotype	IgG
Concentration	1.04 mg/mL
Antigen	Aquaporin 5
Gene Symbols	AQP5
Regulatory Status	RUO
Purification Method	Affinity Chromatography
Gene Alias	AQP 5; Aqp5; AQP-5; aquaporin 5; Aquaporin5; aquaporin-5; PPKB
Gene	AQP5
Product Type	Antibody
Gene ID (Entrez)	11830, 25241, 362
Formulation	PBS with 50% glycerol and 0.02% sodium azide; pH 7.3
Immunogen	Synthetic peptide.
Classification	Polyclonal
Primary or Secondary	Primary

819

Invitrogen™ Rabbit anti-Human IgG4 Recombinant Secondary Antibody

Rabbit Recombinant Monoclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Isotype	IgG
Concentration	1 mg/mL
Antigen	Human IgG4
Regulatory Status	RUO
Purification Method	Protein A
Product Type	Secondary Antibody
Formulation	PBS with 1% BSA, 50% glycerol and 0.09% sodium azide; pH 7.2-7.4
Immunogen	Peptide corresponding to the hinge region of Human IgG4.
Classification	Recombinant Monoclonal
Primary or Secondary	Secondary
Clone	RM120

820

Invitrogen™ Donkey anti-Rat IgG (H+L) Cross-Adsorbed Secondary Antibody, DyLight™ 594

Donkey Polyclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Rat
Host Species	Donkey
Conjugate	DyLight 594
Applications	Flow Cytometry,Immunohistochemistry,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	Rat IgG (H+L) Cross-Adsorbed
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Product Type	Secondary Antibody
Formulation	PBS with 0.2% BSA and 0.09% sodium azide; pH 6.8 to 7.4
Immunogen	Rat IgG-heavy and light chain.
Classification	Polyclonal
Primary or Secondary	Secondary

821

Invitrogen™ Donkey anti-Rat IgG (H+L) Cross-Adsorbed Secondary Antibody, DyLight™ 488

Donkey Polyclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Rat
Host Species	Donkey
Conjugate	DyLight 488
Applications	Flow Cytometry,Immunohistochemistry,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	Rat IgG (H+L) Cross-Adsorbed
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Product Type	Secondary Antibody
Formulation	PBS with 0.2% BSA and 0.09% sodium azide; pH 6.8 to 7.4
Immunogen	Rat IgG-heavy and light chain.
Classification	Polyclonal
Primary or Secondary	Secondary

822

Invitrogen™ Donkey anti-Rat IgG (H+L) Cross-Adsorbed Secondary Antibody, DyLight™ 550

Donkey Polyclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Rat
Host Species	Donkey
Conjugate	DyLight 550
Applications	Flow Cytometry,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	Rat IgG (H+L) Cross-Adsorbed
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Product Type	Secondary Antibody
Formulation	PBS with 0.2% BSA and 0.09% sodium azide; pH 6.8 to 7.4
Immunogen	Rat IgG-heavy and light chain.
Classification	Polyclonal
Primary or Secondary	Secondary

823

Invitrogen™ Donkey anti-Goat IgG (H+L) Cross-Adsorbed Secondary Antibody, DyLight™ 488

Donkey Polyclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Goat
Host Species	Donkey
Conjugate	DyLight 488
Applications	Flow Cytometry,Immunohistochemistry,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	Goat IgG (H+L) Cross-Adsorbed,Goat IgG (H+L)
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Product Type	Secondary Antibody
Formulation	PBS with 0.09% sodium azide; pH 6.8 to 7.4
Immunogen	Goat IgG-heavy and light chain.
Classification	Polyclonal
Primary or Secondary	Secondary

824

Invitrogen™ Goat anti-Human IgE Secondary Antibody

Goat Polyclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human
Host Species	Goat
Conjugate	Unconjugated
Applications	ELISA,Immunoelectrophoresis,Immunohistochemistry,Western Blot
Form	Liquid
Gene Accession No.	P01834, P01857, P01859, P01860, P01861, P01876, P01877, P0CG04
Isotype	IgG
Concentration	1 mg/mL
Antigen	Human IgE
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	HCAK1; IgA1; IgG3; IGHA1; IGHA2; IGHG1; IGHG2; IGHG3; IGHG4; IGKC; IGKCD; IGLC; IGLC1; immunoglobulin heavy constant alpha 1; immunoglobulin heavy constant alpha 2 (A2m marker); immunoglobulin heavy constant gamma 1 (G1m marker); immunoglobulin heavy constant gamma 2 (G2m marker); immunoglobulin heavy constant gamma 3 (G3m marker); immunoglobulin heavy constant gamma 4 (G4m marker); immunoglobulin kappa constant; immunoglobulin lambda constant 1; Km
Gene	IGHA1
Product Type	Secondary Antibody
Gene ID (Entrez)	3493, 3494, 3500, 3501, 3502, 3503, 3514, 3537
Formulation	PBS with 0.09% sodium azide; pH 7.2
Immunogen	Human IgE.
Classification	Polyclonal
Primary or Secondary	Secondary

825

Invitrogen™ Goat anti-Mouse IgG Fc Recombinant Secondary Antibody

Goat Recombinant Monoclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Mouse
Host Species	Goat
Conjugate	Unconjugated
Applications	ELISA,Western Blot
Form	Liquid
Isotype	IgG
Concentration	1 mg/mL
Antigen	Mouse IgG Fc
Regulatory Status	RUO
Purification Method	Protein G
Product Type	Secondary Antibody
Formulation	PBS with 1% BSA, 50% glycerol and 0.09% sodium azide; pH 7.2-7.4
Immunogen	Peptide corresponding to Mouse IgG.
Classification	Recombinant Monoclonal
Primary or Secondary	Secondary
Clone	RMG06

Prev
1
...
53
54
55
56
...
110,641
Next

Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ C/EBP alpha Monoclonal Antibody (15C8) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Apolipoprotein E/ApoE Antibody - BSA Free, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Invitrogen™ COL1A1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ EphB1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TRAC Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NRG1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Osteocalcin Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Aquaporin 5 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ C/EBP alpha Monoclonal Antibody (15C8)

Apolipoprotein E/ApoE Antibody - BSA Free, Novus Biologicals™

Invitrogen™ COL1A1 Polyclonal Antibody

Invitrogen™ EphB1 Polyclonal Antibody

Invitrogen™ TRAC Polyclonal Antibody

Invitrogen™ NRG1 Polyclonal Antibody

Invitrogen™ Osteocalcin Polyclonal Antibody

Invitrogen™ Aquaporin 5 Polyclonal Antibody