Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.

Search Within Results

811 – 825 of 1,746,418 results

811

Invitrogen™ Phospho-S6 (Ser235, Ser236) Recombinant Mouse Monoclonal Antibody (cupk43k)

Mouse Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P62753, P62754
Isotype	IgG1 κ
Concentration	1.0 mg/mL
Antigen	Phospho-S6 (Ser235, Ser236)
Gene Symbols	RPS6
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	(Rp)S6; 40S ribosomal protein S6; air[8]; air8; anon-WO02059370.61; CG10944; CG10944-PA; CG10944-PB; Dmel\CG10944; Dmel_CG10944; DS6; hemocytes enlarged; hen; l(1)air[8]; l(1)air8; l(1)hen; LD31286p; lethal(1)aberrant immune response[8]; lethal-(1)-haemocytes enlarged; lethal-aberrant-immune-response-8; M(1)7BC; M(1)7C; minute; minute (1) 7BC; OK/SW-cl.2; OTTHUMP00000021121; OTTHUMP00000021122; Phosphoprotein NP33; pp30; ribosomal protein S6; Rp S6; RP11-513M16.6; RPS6; RpS6-PA; RpS6-PB; RS6; S6; S6 ribosomal protein; S6R; Small ribosomal subunit protein eS6; wu:fa92e06; wu:fb64g06; zgc:92237
Gene	RPS6
Product Type	Antibody
Gene ID (Entrez)	20104, 6194
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	cupk43k

812

CD38 Monoclonal Antibody (90), PerCP-eFluor™ 710, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	PerCP-eFluor 710
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P56528
Concentration	0.2 mg/mL
Antigen	CD38
Gene Symbols	CD38
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	2'-phospho-ADP-ribosyl cyclase; 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase; 2'-phospho-cyclic-ADP-ribose transferase; ADPRC 1; ADPRC1; ADP-ribosyl cyclase 1; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1; cADPr hydrolase 1; Cd38; CD38 antigen; CD38 antigen (ADP-ribosyl cyclase / cyclic ADP-ribose hydrolase); CD38 antigen (p45); CD38 antigen p45; CD38 molecule; CD38H; Cd38-rs1; cluster of differentiation 38; cyclic ADP-ribose hydrolase 1; ecto-nicotinamide adenine dinucleotide glycohydrolase; I-19; NAD(+) nucleosidase; NAD+ nucleosidase; NIM-R5 antigen; T10
Gene	CD38
Product Type	Antibody
Gene ID (Entrez)	12494
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	90

813

CD90.1 (Thy-1.1) Monoclonal Antibody (HIS51), Biotin, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse,Rat
Host Species	Mouse
Conjugate	Biotin
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P01830, P01831
Concentration	0.5 mg/mL
Antigen	CD90.1 (Thy-1.1)
Gene Symbols	Thy1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CD7; CD90; FLJ33325; T25; Thy 1.2; Thy1; Thy-1; Thy-1 antigen; Thy-1 cell surface antigen; thy-1 glycoprotein; thy-1 membrane glycoprotein; Thy-1 protein; Thy1.1; Thy1.2; Thy-1.2; thymus cell antigen 1, theta; Thymus cell surface antigen
Gene	Thy1
Product Type	Antibody
Gene ID (Entrez)	21838, 24832
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	HIS51

814

Invitrogen™ HuD Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	O09032, P26378, Q61701
Isotype	IgG
Concentration	500 μg/mL
Antigen	HuD
Gene Symbols	ELAVL4
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Elav; ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D); ELAV like neuron-specific RNA binding protein 4; ELAVL4; ELAV-like protein 4; Hu antigen D; HU-antigen D; Hud; Paraneoplastic encephalomyelitis antigen HuD; PNEM; RGD1561943; r-HuD; RNA-binding protein HUD3
Gene	ELAVL4
Product Type	Antibody
Gene ID (Entrez)	15572, 1996, 432358
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human ELAVL4 (8-45aa MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK).
Classification	Polyclonal
Primary or Secondary	Primary

815

Invitrogen™ NPM1 Monoclonal Antibody (FC-61991)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,RNA Immunoprecipitation,Immunocytochemistry
Form	Liquid
Gene Accession No.	P06748, P13084, Q61937
Isotype	IgG1
Concentration	0.5 mg/mL
Antigen	NPM1
Gene Symbols	NPM1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	B23; B23 antibody; B23NP; MGC104254; mNPM antibody; mNPM1 antibody; NO38; NO38 antibody; Npm; npm1; npm1.L; Nucleolar phosphoprotein B23; nucleolar protein B23.1; nucleolar protein B23/No38; nucleolar protein NO38; Nucleophosmin; nucleophosmin (nucleolar phosphoprotein B23, numatrin); nucleophosmin (nucleolar phosphoprotein B23, numatrin) L homeolog; nucleophosmin 1; nucleophosmin/nucleoplasmin family, member 1; nucleoplasmin; numatrin; numatrin antibody; testicular tissue protein Li 128; unnamed protein product; XELAEV_18020022mg
Gene	NPM1
Product Type	Antibody
Gene ID (Entrez)	18148, 25498, 4869
Formulation	PBS with 0.1% sodium azide; pH 7.4
Immunogen	NPM/B23 purified from rat hepatoma.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	FC-61991

816

Invitrogen™ MUC4 Monoclonal Antibody (1G8)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q63661, Q8JZM8, Q99102
Isotype	IgG1
Concentration	0.5 mg/mL
Antigen	MUC4
Gene Symbols	MUC4
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	4933405I11Rik; Ascites sialoglycoprotein; Ascites sialoglycoprotein 1; Ascites sialoglycoprotein 2; ASGP; ASGP1; ASGP-1; ASGP-2; HSA276359; MUC4; MUC-4; mucin 4; mucin 4, ASGP; mucin 4, cell surface associated; mucin 4, tracheobronchial; Mucin4; mucin-4; Mucin-4 alpha chain; Mucin-4 beta chain; Pancreatic adenocarcinoma mucin; pre-sialomucin complex; Psmc; sialomucin ascites sialoglycoprotein-1; sialomucin complex; testis mucin; Tracheobronchial mucin
Gene	MUC4
Product Type	Antibody
Gene ID (Entrez)	140474, 303887, 4585
Formulation	PBS with 0.1% sodium azide; pH 7.4
Immunogen	Rat ASGP-2.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	1G8

817

CD170 (Siglec F) Monoclonal Antibody (1RNM44N), Brilliant Ultra Violet™ 395, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	Brilliant Ultraviolet 395
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	Q920G3
Concentration	0.2 mg/mL
Antigen	CD170 (Siglec F)
Gene Symbols	Siglecf
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	SIGLEC-8
Gene	Siglecf
Product Type	Antibody
Gene ID (Entrez)	233186
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	1RNM44N

818

Invitrogen™ Aurora B Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q96GD4
Isotype	IgG
Concentration	0.25 mg/mL
Antigen	Aurora B
Gene Symbols	AURKB
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Aik2; AIM1; AIM-1; AIRK2; AL022959; ARK2; ARK-2; AurB; AURKB; aurkb-sv1; aurkb-sv2; aurora 1; aurora- and IPL1-like midbody-associated protein 1; aurora B; aurora kinase B; aurora kinase B-Sv1; aurora kinase B-Sv2; aurora/IPL1-related kinase 2; aurora-1; aurora-B; aurora-related kinase 2; IPL1; PPP1R48; protein phosphatase 1, regulatory subunit 48; serine/threonine kinase; serine/threonine kinase 12; serine/threonine kinase 5; Serine/threonine-protein kinase 12; Serine/threonine-protein kinase 5; serine/threonine-protein kinase aurora-B; STK1; STK-1; Stk12; STK12; AIK2; AIM1; ARK2; IPL1; AIM-1; STK5
Gene	AURKB
Product Type	Antibody
Gene ID (Entrez)	9212
Formulation	PBS with 0.1% sodium azide; pH 7.4
Immunogen	Synthetic peptide derived from the N-terminal region of the human Aurora B protein.
Classification	Polyclonal
Primary or Secondary	Primary

819

Invitrogen™ TACR1 Monoclonal Antibody (ZN003)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat,Insect
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P14600, P25103, P30548
Isotype	IgG1 κ
Concentration	0.5 mg/mL
Antigen	TACR1
Gene Symbols	Tacr1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	neurokinin 1 receptor; neurokinin receptor 1; neurokinin receptor subtype NK1; neurokinin-1 receptor; Nk1 receptor; NK-1 receptor; Nk1r; NK-1R; NKIR; SPR; substance p receptor; substance-P receptor; TAC1R; tachykinin receptor 1; tachykinin receptor 1 (substance P receptor; neurokinin-1 receptor); TACR1; truncated neurokinin-1 receptor
Gene	Tacr1
Product Type	Antibody
Gene ID (Entrez)	21336, 24807, 6869
Formulation	PBS with 0.1% sodium azide; pH 7.4
Immunogen	Synthetic peptide derived from an internal sequence of the human, mouse, and rat NK1 receptor proteins.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	ZN003

820

CD45.2 Monoclonal Antibody (104), Brilliant Violet™ 711, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Mouse
Conjugate	Brilliant Violet 711
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P06800
Concentration	0.2 mg/mL
Antigen	CD45.2
Gene Symbols	Ptprc
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	B220; Cd45; CD45 antigen; CD45R; GP180; LCA; L-CA; leukocyte common antigen; loc; LY5; Ly-5; lymphocyte antigen 5; lymphocyte common antigen; Lyt-4; protein tyrosine phosphatase, receptor type, C; Ptprc; Receptor-type tyrosine-protein phosphatase C; T200; T200 glycoprotein
Gene	Ptprc
Gene ID (Entrez)	19264
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	104

821

MHC Class II (I-A/I-E) Monoclonal Antibody (M5/114.15.2), Brilliant Ultra Violet™ 496, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	Brilliant Ultraviolet 496
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2b κ
Gene Accession No.	P01910, P01921, P04227, P04228, P04230, P06342, P06343, P06344, P06345, P06346, P14434, P14435, P14436, P14437, P14438, P14483, P23150
Concentration	0.2 mg/mL
Antigen	MHC Class II (I-A/I-E)
Gene Symbols	H2-Aa, H2-Ab1, H2-Eb1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Abeta; AI323765; AI845868; cell surface glycoprotein; E-alpha-f; H-2 class II histocompatibility antigen, A beta chain; H-2 class II histocompatibility antigen, E-D alpha chain; H-2 class II histocompatibility antigen, E-K alpha chain; H-2 class II histocompatibility antigen, E-U alpha chain; H-2 class II histocompatibility antigen, I-E beta chain; H-2Ab; H2-Ab; H2-Ab1; H-2Ea; H2-Ea; H2-Ea-ps; H2Eb; H-2Eb; H2-Eb1; H2-iabeta; H2-IE-alpha; histocompatibility 2, class II antigen A, beta 1; histocompatibility 2, class II antigen E alpha; histocompatibility 2, class II antigen E alpha, pseudogene; histocompatibility 2, class II antigen E beta; Ia2; Ia-2; Ia3; Ia-3; Ia4; Ia-4; IAb; I-Ab; I-Abeta; I-Ad; I-Aq; I-E alpha MHC class II; I-E beta MHC class II; I-Ealpha; I-Ed; I-Ek; major histocompatibility complex class II beta chain; major histocompatibility complex H-2E beta chain; MHC class 2; MHC class II antigen A beta; MHC class II antigen E alpha; MHC class II H2-IA-beta-psi; MHC class II IE-b; MHC class II protein; MHC H2-IE-beta cell surface glycoprotein; response to metastatic cancers 1; Rmcs1
Gene	H2-Ab1
Product Type	Antibody
Gene ID (Entrez)	14960, 14961, 14969
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	M5/114.15.2

822

Invitrogen™ PLK1 Monoclonal Antibody (36-298)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P53350, Q07832, Q62673
Isotype	IgG1
Concentration	0.5 mg/mL
Antigen	PLK1
Gene Symbols	Plk1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	cell cycle regulated protein kinase; Plk; PLK 1; Plk1; PLK-1; plk1.S; plx1; polo (Drosophia)-like kinase; polo like kinase; polo like kinase 1; polo like kinase 1 S homeolog; polo-like kinase; polo-like kinase 1; polo-like kinase homolog; polo-like protein kinase; serine/threonine-protein kinase 13; Serine/threonine-protein kinase PLK1; STPK13; STPK14; Unknown (protein for MGC:133927); XELAEV_18047692mg
Gene	Plk1
Product Type	Antibody
Gene ID (Entrez)	18817, 25515, 5347
Formulation	PBS with 0.1% sodium azide; pH 7.4
Immunogen	Full-length human Plk1.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	36-298

823

IL-33R (ST2) Monoclonal Antibody (RMST2-2), Brilliant Violet™ 421, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	Brilliant Violet 421
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P14719
Concentration	0.2 mg/mL
Antigen	IL-33R (ST2)
Gene Symbols	IL1RL1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	DER4; Fit1; Fit-1; Fos-responsive gene 1 protein; growth stimulation-expressed; homolog of mouse growth stimulation-expressed; IL-1 R4; IL1RL1; IL-1RL1; IL33R; IL-33R; interleukin 1 receptor like 1; interleukin 1 receptor-like 1; interleukin 1 receptor-related protein; Interleukin1 receptor like 1; interleukin-1 receptor-like 1; Interleukin-33 receptor alpha chain; Ly84; lymphocyte antigen 84; Protein ST2; Protein T1; sIL 33R; soluble IL 33 Receptor; soluble IL 33R; St2; ST2L; St2-rs1; ST2V; Ste2; T1; T1/ST2
Gene	IL1RL1
Gene ID (Entrez)	17082
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	RMST2-2

824

CD14 Monoclonal Antibody (61D3), Brilliant Violet™ 605, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Brilliant Violet 605
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P08571
Concentration	5 μL/Test
Antigen	CD14
Gene Symbols	Cd14
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CD 14; CD14; CD14 antigen; CD14 molecule; cd14 monocyte; lipopolysaccharide receptor; lipoprotein receptor; LPSR antibody; monocyte differentiation antigen CD14; Monocyte differentiation antigen CD14, membrane-bound form; Monocyte differentiation antigen CD14, urinary form; monocyte differentiation antigen CD14; LOW QUALITY PROTEIN: monocyte differentiation antigen CD14; myeloid cell-specific leucine-rich glycoprotein; myeloid membrane glycoprotein precursor; sCD14; soluble CD14
Gene	Cd14
Gene ID (Entrez)	929
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	61D3

825

CD45 Monoclonal Antibody (HI30), Brilliant Violet™ 711, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Brilliant Violet 711
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P08575
Concentration	5 μL/Test
Antigen	CD45
Gene Symbols	PTPRC
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	B220; cd45; CD45 antigen; CD45 antigen isoform 1 precursor; CD45 antigen isoform 2 precursor; CD45 antigen isoform 3 precursor; CD45 antigen isoform 4 precursor; CD45 antigen isoform 5 precursor; CD45 antigen isoform 6 precursor; CD45R; GP180; Lca; L-CA; leucocyte common antigen; leukocyte common antigen; leukocyte common antigen A; leukocyte common antigen B; leukocyte common antigen, CD45; loc; LOW QUALITY PROTEIN: receptor-type tyrosine-protein phosphatase C; LY5; Ly-5; lymphocyte antigen 5; lymphocyte common antigen; Lyt-4; membrane tyrosine phosphatase; protein tyrosine phosphatase lambda; protein tyrosine phosphatase receptor type C; protein tyrosine phosphatase, receptor type C; protein tyrosine phosphatase, receptor type, C; protein tyrosine phosphatase, receptor type, c polypeptide; Protein tyrosine phosphatase, receptor-type, c polypeptide; protein tyrosine phosphatase; alternatively spliced; Ptprc; Receptor-type tyrosine-protein phosphatase C; RT7; T200; T200 glycoprotein; T200 leukocyte common antigen; T220 and B220
Gene	PTPRC
Product Type	Antibody
Gene ID (Entrez)	5788
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	HI30

Antibodies

Filtered Search Results

Narrow Results

CD38 Monoclonal Antibody (90), PerCP-eFluor™ 710, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD90.1 (Thy-1.1) Monoclonal Antibody (HIS51), Biotin, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ HuD Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NPM1 Monoclonal Antibody (FC-61991) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MUC4 Monoclonal Antibody (1G8) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD170 (Siglec F) Monoclonal Antibody (1RNM44N), Brilliant Ultra Violet™ 395, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Aurora B Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TACR1 Monoclonal Antibody (ZN003) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD45.2 Monoclonal Antibody (104), Brilliant Violet™ 711, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

MHC Class II (I-A/I-E) Monoclonal Antibody (M5/114.15.2), Brilliant Ultra Violet™ 496, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PLK1 Monoclonal Antibody (36-298) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

IL-33R (ST2) Monoclonal Antibody (RMST2-2), Brilliant Violet™ 421, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD14 Monoclonal Antibody (61D3), Brilliant Violet™ 605, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD45 Monoclonal Antibody (HI30), Brilliant Violet™ 711, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD38 Monoclonal Antibody (90), PerCP-eFluor™ 710, eBioscience™, Invitrogen™

CD90.1 (Thy-1.1) Monoclonal Antibody (HIS51), Biotin, eBioscience™, Invitrogen™

Invitrogen™ HuD Polyclonal Antibody

Invitrogen™ NPM1 Monoclonal Antibody (FC-61991)

Invitrogen™ MUC4 Monoclonal Antibody (1G8)

CD170 (Siglec F) Monoclonal Antibody (1RNM44N), Brilliant Ultra Violet™ 395, eBioscience™, Invitrogen™

Invitrogen™ Aurora B Polyclonal Antibody

Invitrogen™ TACR1 Monoclonal Antibody (ZN003)

CD45.2 Monoclonal Antibody (104), Brilliant Violet™ 711, eBioscience™, Invitrogen™

MHC Class II (I-A/I-E) Monoclonal Antibody (M5/114.15.2), Brilliant Ultra Violet™ 496, eBioscience™, Invitrogen™

Invitrogen™ PLK1 Monoclonal Antibody (36-298)

IL-33R (ST2) Monoclonal Antibody (RMST2-2), Brilliant Violet™ 421, eBioscience™, Invitrogen™

CD14 Monoclonal Antibody (61D3), Brilliant Violet™ 605, eBioscience™, Invitrogen™

CD45 Monoclonal Antibody (HI30), Brilliant Violet™ 711, eBioscience™, Invitrogen™