Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.

Search Within Results

1,036 – 1,050 of 1,903,137 results

1,036

Invitrogen™ Phospho-EGFR (Tyr992) Recombinant Rabbit Monoclonal Antibody (3H24L5)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunocytochemistry
Form	Liquid
Gene Accession No.	P00533
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	Phospho-EGFR (Tyr992)
Gene Symbols	EGFR
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	2.7.10.1; 9030024J15Rik; AI552599; avian erythroblastic leukemia viral (v-erbB) oncogene homolog; avian erythroblastic leukemia viral (v-erb-b) oncogene homolog; cell growth inhibiting protein 40; cell proliferation-inducing protein 61; EC 2.7.10.1; egf receptor; Egfr; EGFR-related peptide; epidermal growth factor receptor; epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian); Epidermal growth factor receptor formerly avian erythroblastic leukemia viral (v-erbB) oncogene homolog (Erbb1); epidermal growth factor receptor, formerly avian erythroblastic leukemia viral (v-erbB) oncogene homolog (Erbb1); ERBB; ERBB1; ErbB-1; erb-b2 receptor tyrosine kinase 1; Errb1; Errp; HER1; kinase EGFR; mENA; NISBD2; Oncogene ERBB; PIG61; Proto-oncogene c-ErbB-1; receptor tyrosine-protein kinase erbB-1; Urogastrone; wa2; wa-2; Wa5; waved 2
Gene	EGFR
Product Type	Antibody
Gene ID (Entrez)	1956
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Peptide corresponding to Human EGFR (aa 1012-1020).
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	3H24L5

1,037

Invitrogen™ FKBP12 Recombinant Rabbit Monoclonal Antibody (1H38L2)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Hamster,Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	P26883, P62942, Q62658
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	FKBP12
Gene Symbols	FKBP1A
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	12 kDa FK506-binding protein; 12 kDa FKBP; calstabin 1; calstabin-1; EC 5.2.1.8; FK506 binding protein 1a; FK506 binding protein 1A, 12kDa; FK506 binding protein 2 (13 kDa); FK506 binding protein12; FK506-binding protein 1; FK506-binding protein 1 (12kD); FK506-binding protein 12; FK506-binding protein 1a; FK506-binding protein 1A (12kD); FK506-binding protein, T-cell, 12-kD; Fkbp; FKBP1; FKBP12; FKBP-12; FKBP12-Exip3; Fkbp1a; FKBP-1A; Fkbp2; Immunophilin FKBP12; peptidyl-prolyl cis-trans isomerase FKBP1A; PKC12; PKCI2; PPIASE; PPIase FKBP1A; protein kinase C inhibitor 2; rotamase
Gene	FKBP1A
Product Type	Antibody
Gene ID (Entrez)	100763474, 14225, 2280, 25639
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Peptides corresponding to human FKBP12 [1) aa72-85 2) aa55-66].
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	1H38L2

1,038

Invitrogen™ CD4 Monoclonal Antibody (S3.5), PE

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark
Target Species	Human
Host Species	Mouse
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P01730
Isotype	IgG2a
Antigen	CD4
Gene Symbols	CD4
Regulatory Status	RUO,RUO
Purification Method	Purified
Gene Alias	Activation B7-1 antigen; B7; B7.1; B7-1; BB1; B-lymphocyte activation antigen B7; CD28LG; CD28LG1; CD4; CD4 antigen; CD4 antigen (p55); CD4 antigen p55; Cd4 molecule; CD4 precursor; CD4 receptor; CD4, allele 1; cd4a; CD4mut; CD80; CD80 antigen (CD28 antigen ligand 1, B7-1 antigen); CD80 molecule; cell surface glycoprotein CD4; costimulatory factor CD80; costimulatory molecule variant IgV-CD80; CTLA-4 counter-receptor B7.1; fCD4; L3T4; LAB7; Leu-3; Ly-4; lymphocyte antigen CD4; lymphocyte antigen CD4 precursor; membrane protein; p55; T-cell differentiation antigen L3T4; T-cell surface antigen T4/Leu-3; T-cell surface glycoprotein CD4; T-cell surface glycoprotein CD4 precursor (T-cell surface antigen T4/Leu-3) (T-cell differentiation antigen L3T4); T-lymphocyte activation antigen CD80; W3/25; W3/25 antigen
Gene	CD4
Product Type	Antibody
Gene ID (Entrez)	920
Formulation	PBS with BSA, sucrose and 0.1% sodium azide
Immunogen	Human CD4.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	S3.5

1,039

Invitrogen™ SLC34A2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	O95436, Q9DBP0, Q9JJ09
Isotype	IgG
Concentration	500 μg/mL
Antigen	SLC34A2
Gene Symbols	SLC34A2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AA536683; D5Ertd227e; Na(+)/Pi cotransporter 2B; Na(+)-dependent phosphate cotransporter 2B; NAPI IIb; NaPi-2b; NaPi3b; NAPI-3B; NAPI-IIb; Npt2b; NPTIIb; rNaPi IIb; Slc34a2; Sodium/phosphate cotransporter 2B; Sodium-dependent phosphate transport protein 2B; sodium-phosphate transport protein 2B; solute carrier family 34 (sodium phosphate), member 2; solute carrier family 34 (type II sodium/phosphate contransporter), member 2; solute carrier family 34 (type II sodium/phosphate cotransporter), member 2; solute carrier family 34 member 2; type II sodium-dependent phosphate transporter 3b; type IIb Na/Picotransporter; type IIb sodium-phosphate transporter
Gene	SLC34A2
Product Type	Antibody
Gene ID (Entrez)	10568, 20531, 84395
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence of human SLC34A2 (QNWTMKNVTYKENIAKCQHIFVNFHLPDLA).
Classification	Polyclonal
Primary or Secondary	Primary

1,040

Invitrogen™ CD71 (Transferrin Receptor) Monoclonal Antibody (OKT9 (OKT-9)), Super Bright™ 600, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Super Bright 600
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P02786
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	CD71 (Transferrin Receptor)
Gene Symbols	TFRC
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	2610028K12Rik; AI195355; AI426448; AU015758; CD antigen CD71; CD71; chicken transferrin receptor; E430033M20Rik; I79_000642; IMD46; mammary tumor virus receptor 1; Mtvr1; Mtvr-1; p90; sTfR; T9; TfR; tfR1; TFR2; TFRC; TR; transferrin receptor; transferrin receptor (p90, CD71); transferrin receptor 2; transferrin receptor protein 1; Transferrin receptor protein 1, serum form; Trfr
Gene	TFRC
Product Type	Antibody
Gene ID (Entrez)	7037
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	OKT9 (OKT-9)

1,041

Invitrogen™ N-Ras Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	P01111, P08556, Q04970
Isotype	IgG
Concentration	1 mg/mL
Antigen	N-Ras
Gene Symbols	NRAS
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	ALPS4; AV095280; CMNS; GTPase NRas; HRAS1; NCMS; Neuroblastoma RAS; neuroblastoma ras oncogene; neuroblastoma RAS viral (v-ras) oncogene homolog; neuroblastoma RAS viral oncogene homolog; Nras; N-ras; N-ras protein part 4; NRAS1; NS6; RAS; RASN; transforming protein N-Ras; v-ras neuroblastoma RAS viral oncogene homolog
Gene	NRAS
Product Type	Antibody
Gene ID (Entrez)	18176, 24605, 4893
Formulation	PBS with 0.02% sodium azide
Immunogen	A 15 amino acid peptide near the carboxy terminus of human N-RAS.
Classification	Polyclonal
Primary or Secondary	Primary

1,042

Invitrogen™ CD62P (P-Selectin) Monoclonal Antibody (Psel.KO2.3), Brilliant Violet™ 786, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	Brilliant Violet 786
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P16109, Q01102
Isotype	IgG1 κ
Concentration	0.2 mg/mL
Antigen	CD62P (P-Selectin)
Gene Symbols	SELP
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CD62; CD62 antigen-like family member P; CD62P; CD62P antigen; CD62P; CD62 homolog; FLJ45155; GMP140; GMP-140; GMRP; Granule membrane protein 140; granule membrane protein 140kDa; granulocyte membrane protein; Grmp; LECAM3; leukocyte-endothelial cell adhesion molecule 3; PADGEM; Platelet activation dependent granule-external membrane protein; platelet alpha-granule membrane protein; PSEL; PSELECT; P-selectin; P-selectin precursor; RP1-86F14.2; selectin P; selectin P (granule membrane protein 140kDa, antigen CD62); selectin, platelet; Selp
Gene	SELP
Product Type	Antibody
Gene ID (Entrez)	20344, 6403
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	Psel.KO2.3

1,043

Invitrogen™ E. coli serotype O/K Polyclonal Antibody, FITC

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. Store in the dark.
Target Species	Bacteria
Host Species	Rabbit
Conjugate	FITC
Applications	Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	5.0 mg/mL
Antigen	E. coli serotype O/K
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	Escherichia coli
Product Type	Antibody
Formulation	PBS with 10mg/mL BSA and 0.1% sodium azide; pH 7.2
Immunogen	O and K antigenic serotypes (All types) of Escherichia coli.
Classification	Polyclonal
Primary or Secondary	Primary

1,044

CD62L (L-Selectin) Monoclonal Antibody (MEL-14), Brilliant Violet™ 786, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	Brilliant Violet 786
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P18337
Concentration	0.2 mg/mL
Antigen	CD62L (L-Selectin)
Gene Symbols	SELL
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	A.11; AI528707; CD62 antigen-like family member L; CD62L; gp90-MEL; hLHRc; LAM1; LAM-1; LECAM1; LECAM-1; LEU8; Leu-8; Leukocyte adhesion molecule 1; leukocyte surface antigen Leu-8; Leukocyte-endothelial cell adhesion molecule 1; LNHR; LSEL; L-selectin; Ly22; Ly-22; LYAM1; Lyam-1; Ly-m22; Lymph node homing receptor; lymphocyte adhesion molecule 1; lymphocyte antigen 22; Lymphocyte surface MEL-14 antigen; pln homing receptor; PLNHR; SELE; selectin E (endothelial adhesion molecule 1); selectin L; selectin L (lymphocyte adhesion molecule 1); selectin, lymphocyte; Sell; TQ1
Gene	SELL
Gene ID (Entrez)	20343
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MEL-14

1,045

Invitrogen™ THRA Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Chicken,Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Gel Shift,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P04625, P10827, P63058, P63059
Isotype	IgG
Concentration	Conc. Not Determined
Antigen	THRA
Gene Symbols	Thra
Regulatory Status	RUO
Gene Alias	6430529J03Rik; AR7; avian erythroblastic leukemia viral (v-erb-a) oncogene homolog 1; AW259572; cerbA protein; c-erb-A protein; c-erb-A thyroid hormone receptor; c-ERBA-1; cerbAalpha; c-erbAalpha; c-erbA-alpha; c-erbAalpha2; c-erbA-alpha2; c-erbAalpha2; thyroid hormone receptor alpha; CHNG6; E ERB-T-1; EAR7; EAR-7; ERBA; ERBA ALPHA; ERBA related 7; ERBA1; ERBA-related 7; ERB-T-1; MGC000261; MGC43240; NR1A1; Nuclear receptor subfamily 1 group A member 1; Oncogene ERBA; Rvr; T3R[a]; T3Ralpha; Thra; THRA1; THRA2; Thyroid hormone receptor alpha; thyroid hormone receptor alpha 1; thyroid hormone receptor alpha 1 (avian erythroblastic leukemia viral (v-erb-a) oncogene homolog 1 formerly ERBA1); thyroid hormone receptor alpha 2; thyroid hormone receptor beta; thyroid hormone receptor, alpha; thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian); thyroid normone nuclear receptor alpha variant 1; TR; TR alpha 1; TR alpha 1+2; TR alpha 2; triiodothyronine receptor; unnamed protein product; V-erbA-related protein 7
Gene	Thra
Product Type	Antibody
Gene ID (Entrez)	21833, 396251, 7067, 81812
Formulation	Whole serum, PBS with 0.05% sodium azide
Immunogen	Synthetic Peptide: E(403) V F E D Q E V(410).
Classification	Polyclonal
Primary or Secondary	Primary

1,046

Invitrogen™ Legionella Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Bacteria
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	5 mg/mL
Antigen	Legionella
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	L. pneumophila; Legionellosis
Product Type	Antibody
Formulation	PBS with 0.1% sodium azide; pH 7.2
Immunogen	A whole cell preparation of Legionella pneumophila; ATCC #33152.
Classification	Polyclonal
Primary or Secondary	Primary

1,047

Invitrogen™ Donkey anti-Mouse IgG (H+L) Secondary Antibody, Texas Red

Donkey Polyclonal Secondary Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. Store in the dark.
Target Species	Mouse
Host Species	Donkey
Conjugate	Texas Red
Applications	Dot Blot,ELISA,Flow Cytometry,Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	2 mg/mL
Antigen	Mouse IgG (H+L)
Regulatory Status	RUO
Purification Method	IgG fraction
Product Type	Secondary Antibody
Formulation	PBS with 1% BSA and 0.01% sodium azide; pH 7.2
Immunogen	Mouse IgG whole molecule.
Classification	Polyclonal
Primary or Secondary	Secondary

1,048

CD205 Monoclonal Antibody (205yekta), Super Bright™ 600, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	Super Bright 600
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	Q60767
Concentration	0.2 mg/mL
Antigen	CD205
Gene Symbols	LY75
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene	LY75
Product Type	Antibody
Gene ID (Entrez)	17076
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	205yekta

1,049

MHC Class II (I-A/I-E) Monoclonal Antibody (M5/114.15.2), Super Bright™ 600, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	Super Bright 600
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2b κ
Gene Accession No.	P01910, P01921, P04227, P04228, P04230, P06342, P06343, P06344, P06345, P06346, P14434, P14435, P14436, P14437, P14438, P14483, P23150
Concentration	0.2 mg/mL
Antigen	MHC Class II (I-A/I-E)
Gene Symbols	H2-Aa, H2-Ab1, H2-Eb1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Abeta; AI323765; AI845868; cell surface glycoprotein; E-alpha-f; H-2 class II histocompatibility antigen, A beta chain; H-2 class II histocompatibility antigen, E-D alpha chain; H-2 class II histocompatibility antigen, E-K alpha chain; H-2 class II histocompatibility antigen, E-U alpha chain; H-2 class II histocompatibility antigen, I-E beta chain; H-2Ab; H2-Ab; H2-Ab1; H-2Ea; H2-Ea; H2-Ea-ps; H2Eb; H-2Eb; H2-Eb1; H2-iabeta; H2-IE-alpha; histocompatibility 2, class II antigen A, beta 1; histocompatibility 2, class II antigen E alpha; histocompatibility 2, class II antigen E alpha, pseudogene; histocompatibility 2, class II antigen E beta; Ia2; Ia-2; Ia3; Ia-3; Ia4; Ia-4; IAb; I-Ab; I-Abeta; I-Ad; I-Aq; I-E alpha MHC class II; I-E beta MHC class II; I-Ealpha; I-Ed; I-Ek; major histocompatibility complex class II beta chain; major histocompatibility complex H-2E beta chain; MHC class 2; MHC class II antigen A beta; MHC class II antigen E alpha; MHC class II H2-IA-beta-psi; MHC class II IE-b; MHC class II protein; MHC H2-IE-beta cell surface glycoprotein; response to metastatic cancers 1; Rmcs1
Gene	H2-Aa
Product Type	Antibody
Gene ID (Entrez)	14960, 14961, 14969
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	M5/114.15.2

1,050

Invitrogen™ VSIG4 Monoclonal Antibody (JAV4), Brilliant Violet™ 650, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Brilliant Violet 650
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	Q9Y279
Isotype	IgG2a κ
Concentration	5 μL/Test
Antigen	VSIG4
Gene Symbols	VSIG4
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	A530061A11; BC025105; complement receptor of the immunoglobulin superfamily; CRIg; Ig superfamily protein; MGC137243 protein; protein Z39Ig; UNQ317/PRO362; V-set and immunoglobulin domain containing 4; V-set and immunoglobulin domain-containing protein 4; VSIG4; Z39IG
Gene	VSIG4
Product Type	Antibody
Gene ID (Entrez)	11326
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Immunogen	Fc-Protein and CHO cells.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	JAV4

Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ CD4 Monoclonal Antibody (S3.5), PE Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SLC34A2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD71 (Transferrin Receptor) Monoclonal Antibody (OKT9 (OKT-9)), Super Bright™ 600, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ N-Ras Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ E. coli serotype O/K Polyclonal Antibody, FITC Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD62L (L-Selectin) Monoclonal Antibody (MEL-14), Brilliant Violet™ 786, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ THRA Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Legionella Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD205 Monoclonal Antibody (205yekta), Super Bright™ 600, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ VSIG4 Monoclonal Antibody (JAV4), Brilliant Violet™ 650, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD4 Monoclonal Antibody (S3.5), PE

Invitrogen™ SLC34A2 Polyclonal Antibody

Invitrogen™ CD71 (Transferrin Receptor) Monoclonal Antibody (OKT9 (OKT-9)), Super Bright™ 600, eBioscience™

Invitrogen™ N-Ras Polyclonal Antibody

Invitrogen™ E. coli serotype O/K Polyclonal Antibody, FITC

CD62L (L-Selectin) Monoclonal Antibody (MEL-14), Brilliant Violet™ 786, eBioscience™, Invitrogen™

Invitrogen™ THRA Polyclonal Antibody

Invitrogen™ Legionella Polyclonal Antibody

CD205 Monoclonal Antibody (205yekta), Super Bright™ 600, eBioscience™, Invitrogen™

Invitrogen™ VSIG4 Monoclonal Antibody (JAV4), Brilliant Violet™ 650, eBioscience™