Antibodies
Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Keyword Search:
Clear search
1
–
15
of
26
results
Invitrogen™ IBA1 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | O70200, P55008, P55009 |
| Isotype | IgG |
| Concentration | Conc. Not Determined |
| Antigen | IBA1 |
| Gene Symbols | AIF1 |
| Regulatory Status | RUO |
| Gene Alias | AI607846; AIF1; AIF-1; Allograft inflammatory factor 1; balloon angioplasty responsive transcript; balloon angioplasty-responsive transcript 1; Bart1; BART-1; D17H6S50E; DADB-70P7.8; DASS-82G15.2; Em:AF129756.17; G1; Iba; Iba1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; IRT1; IRT-1; microglia response factor; Mrf1; MRF-1; protein BART-1; protein G1; testis specific |
| Gene | AIF1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 11629, 199, 29427 |
| Formulation | Whole serum with 5mM sodium azide |
| Immunogen | Peptide identical to the C-terminal of human IBA1 coupled to KLH. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ IBA1 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Chicken Polyclonal Antibody
| Content And Storage | 4°C |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Chicken |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | O70200, P55008, P55009 |
| Isotype | IgY |
| Concentration | Conc. Not Determined |
| Antigen | IBA1 |
| Gene Symbols | AIF1 |
| Regulatory Status | RUO |
| Gene Alias | AI607846; AIF1; AIF-1; Allograft inflammatory factor 1; balloon angioplasty responsive transcript; balloon angioplasty-responsive transcript 1; Bart1; BART-1; D17H6S50E; DADB-70P7.8; DASS-82G15.2; Em:AF129756.17; G1; Iba; Iba1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; IRT1; IRT-1; microglia response factor; Mrf1; MRF-1; protein BART-1; protein G1; testis specific |
| Gene | AIF1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 11629, 199, 29427 |
| Formulation | PBS with 0.02% sodium azide |
| Immunogen | Peptide identical to part of the C-terminal of human IBA1 coupled to KLH. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ IBA1 Recombinant Rat Monoclonal Antibody (HL1880-RT)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Recombinant Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rat |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | O70200, P55008, P55009 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | IBA1 |
| Gene Symbols | AIF1 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | AI607846; AIF1; AIF-1; Allograft inflammatory factor 1; balloon angioplasty responsive transcript; balloon angioplasty-responsive transcript 1; Bart1; BART-1; D17H6S50E; DADB-70P7.8; DASS-82G15.2; Em:AF129756.17; G1; Iba; Iba1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; IRT1; IRT-1; microglia response factor; Mrf1; MRF-1; protein BART-1; protein G1; testis specific |
| Gene | AIF1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 11629, 199, 29427 |
| Formulation | PBS with no preservative |
| Immunogen | Recombinant fragmemt of human Iba1. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | HL1880-RT |
Invitrogen™ IBA1 Recombinant Mouse Monoclonal Antibody (HL1880-MS)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Recombinant Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | O70200, P55008, P55009 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | IBA1 |
| Gene Symbols | AIF1 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | AI607846; AIF1; AIF-1; Allograft inflammatory factor 1; balloon angioplasty responsive transcript; balloon angioplasty-responsive transcript 1; Bart1; BART-1; D17H6S50E; DADB-70P7.8; DASS-82G15.2; Em:AF129756.17; G1; Iba; Iba1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; IRT1; IRT-1; microglia response factor; Mrf1; MRF-1; protein BART-1; protein G1; testis specific |
| Gene | AIF1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 11629, 199, 29427 |
| Formulation | PBS with no preservative |
| Immunogen | Recombinant fragmemt of human Iba1. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | HL1880-MS |
Invitrogen™ IBA1 Recombinant Rat Monoclonal Antibody (HL22-RT)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Recombinant Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rat |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | O70200, P55008, P55009 |
| Isotype | IgG1 |
| Concentration | 2 mg/mL |
| Antigen | IBA1 |
| Gene Symbols | AIF1 |
| Regulatory Status | RUO |
| Purification Method | Protein G |
| Gene Alias | AI607846; AIF1; AIF-1; Allograft inflammatory factor 1; balloon angioplasty responsive transcript; balloon angioplasty-responsive transcript 1; Bart1; BART-1; D17H6S50E; DADB-70P7.8; DASS-82G15.2; Em:AF129756.17; G1; Iba; Iba1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; IRT1; IRT-1; microglia response factor; Mrf1; MRF-1; protein BART-1; protein G1; testis specific |
| Gene | AIF1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 11629, 199, 29427 |
| Formulation | PBS with no preservative |
| Immunogen | Carrier-protein conjugated synthetic peptide encompassing a sequence within the C-terminus region of human Iba1. The exact sequence is proprietary. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | HL22-RT |
Invitrogen™ IBA1 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | O70200, P55008, P55009 |
| Isotype | IgG |
| Concentration | 0.14 mg/mL |
| Antigen | IBA1 |
| Gene Symbols | AIF1 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | AI607846; AIF1; AIF-1; Allograft inflammatory factor 1; balloon angioplasty responsive transcript; balloon angioplasty-responsive transcript 1; Bart1; BART-1; D17H6S50E; DADB-70P7.8; DASS-82G15.2; Em:AF129756.17; G1; Iba; Iba1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; IRT1; IRT-1; microglia response factor; Mrf1; MRF-1; protein BART-1; protein G1; testis specific |
| Gene | AIF1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 11629, 199, 29427 |
| Formulation | PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7 |
| Immunogen | Recombinant protein encompassing a sequence within the center region of human Iba1. The exact sequence is proprietary. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ IBA1 Recombinant Rabbit Monoclonal Antibody (JM36-62)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Recombinant Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | O70200, P55008, P55009 |
| Isotype | IgG |
| Concentration | 1.092 mg/mL |
| Antigen | IBA1 |
| Gene Symbols | AIF1 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | AI607846; AIF1; AIF-1; Allograft inflammatory factor 1; balloon angioplasty responsive transcript; balloon angioplasty-responsive transcript 1; Bart1; BART-1; D17H6S50E; DADB-70P7.8; DASS-82G15.2; Em:AF129756.17; G1; Iba; Iba1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; IRT1; IRT-1; microglia response factor; Mrf1; MRF-1; protein BART-1; protein G1; testis specific |
| Gene | AIF1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 11629, 199, 29427 |
| Formulation | TBS with 0.05% BSA, 40% glycerol and 0.05% sodium azide; pH 7.4 |
| Immunogen | Synthetic peptide within N-terminal human Iba1. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | JM36-62 |
Invitrogen™ IBA1 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Free Floating),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | O70200, P55008, P55009 |
| Isotype | IgG |
| Concentration | 1.0 mg/mL |
| Antigen | IBA1 |
| Gene Symbols | AIF1 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | AI607846; AIF1; AIF-1; Allograft inflammatory factor 1; balloon angioplasty responsive transcript; balloon angioplasty-responsive transcript 1; Bart1; BART-1; D17H6S50E; DADB-70P7.8; DASS-82G15.2; Em:AF129756.17; G1; Iba; Iba1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; IRT1; IRT-1; microglia response factor; Mrf1; MRF-1; protein BART-1; protein G1; testis specific |
| Gene | AIF1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 11629, 199, 29427 |
| Formulation | PBS with no preservative; pH 7 |
| Immunogen | Carrier-protein conjugated synthetic peptide encompassing a sequence within the C-terminus region of human Iba1. The exact sequence is proprietary. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Human CD42b/GPIb alpha Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Human CD42b/GPIb alpha Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Invitrogen™ IBA1 Monoclonal Antibody (GT10312)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Free Floating),Immunohistochemistry (Paraffin),Western Blot,Western Blot |
| Form | Liquid |
| Gene Accession No. | O70200, P55008, P55009 |
| Isotype | IgG1 |
| Concentration | 1 mg/mL |
| Antigen | IBA1 |
| Gene Symbols | AIF1 |
| Regulatory Status | RUO |
| Purification Method | Protein G |
| Gene Alias | AI607846; AIF1; AIF-1; Allograft inflammatory factor 1; balloon angioplasty responsive transcript; balloon angioplasty-responsive transcript 1; Bart1; BART-1; D17H6S50E; DADB-70P7.8; DASS-82G15.2; Em:AF129756.17; G1; Iba; Iba1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; IRT1; IRT-1; microglia response factor; Mrf1; MRF-1; protein BART-1; protein G1; testis specific |
| Gene | AIF1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 11629, 199, 29427 |
| Formulation | PBS with no preservative; pH 7 |
| Immunogen | Recombinant protein encompassing a sequence within the center region of human Iba1. The exact sequence is proprietary. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | GT10312 |
Invitrogen™ IBA1 Polyclonal Antibody, Biotin
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Goat Polyclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human,Rat |
| Host Species | Goat |
| Conjugate | Biotin |
| Applications | Western Blot |
| Form | Liquid |
| Gene Accession No. | P55008, P55009 |
| Isotype | IgG |
| Concentration | 0.5 mg/mL |
| Antigen | IBA1 |
| Gene Symbols | AIF1 |
| Regulatory Status | RUO |
| Purification Method | Ammonium sulfate precipitation |
| Gene Alias | AI607846; AIF1; AIF-1; Allograft inflammatory factor 1; balloon angioplasty responsive transcript; balloon angioplasty-responsive transcript 1; Bart1; BART-1; D17H6S50E; DADB-70P7.8; DASS-82G15.2; Em:AF129756.17; G1; Iba; Iba1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; IRT1; IRT-1; microglia response factor; Mrf1; MRF-1; protein BART-1; protein G1; testis specific |
| Gene | AIF1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 199, 29427 |
| Formulation | TBS with 0.5% BSA and 0.02% sodium azide; pH 7.3 |
| Immunogen | Peptide with sequence C-TGPPAKKAISELP. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ IBA1 Monoclonal Antibody (C5)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Rat |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Liquid |
| Gene Accession No. | P55009 |
| Isotype | IgG2b κ |
| Concentration | 1 mg/mL |
| Antigen | IBA1 |
| Gene Symbols | AIF1 |
| Regulatory Status | RUO |
| Purification Method | Protein A/G |
| Gene Alias | AI607846; AIF1; AIF-1; Allograft inflammatory factor 1; balloon angioplasty responsive transcript; balloon angioplasty-responsive transcript 1; Bart1; BART-1; D17H6S50E; DADB-70P7.8; DASS-82G15.2; Em:AF129756.17; G1; Iba; Iba1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; IRT1; IRT-1; microglia response factor; Mrf1; MRF-1; protein BART-1; protein G1; testis specific |
| Gene | AIF1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 29427 |
| Formulation | PBS with 50% glycerol and 0.05% ProClin 300; pH 7.4 |
| Immunogen | Recombinant protein Ionized Calcium-binding Adapter Molecule 1. The antigen corresponds to amino acid range 1-147 of the target protein. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | C5 |
Invitrogen™ IBA1 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot |
| Form | Lyophilized |
| Gene Accession No. | P55008 |
| Isotype | IgG |
| Concentration | 500 μg/mL |
| Antigen | IBA1 |
| Gene Symbols | AIF1 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | AI607846; AIF1; AIF-1; Allograft inflammatory factor 1; balloon angioplasty responsive transcript; balloon angioplasty-responsive transcript 1; Bart1; BART-1; D17H6S50E; DADB-70P7.8; DASS-82G15.2; Em:AF129756.17; G1; Iba; Iba1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; IRT1; IRT-1; microglia response factor; Mrf1; MRF-1; protein BART-1; protein G1; testis specific |
| Gene | AIF1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 199 |
| Formulation | PBS with 4mg trehalose and no preservative |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1 (99-133aa ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |