accessibility menu, dialog, popup

UserName
Viewing profile as user:

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (1,886,144)
Primary Antibody Matched Pairs (7,129)
Protein Interaction Antibody Pairs (1,380)
Protein Phosphorylation Antibody Pairs (73)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (1)
  • (4)
  • (1)

brands

  • (2)
  • (1)
  • (1)
  • (28)
  • (2)
  • (2)
  • (969)
  • (76,150)
  • (14,166)
  • (41)
  • (6)
  • (59,912)
  • (1)
  • (110)
  • (259)
  • (2)
  • (1,310)
  • (575)
  • (2)
  • (1)
  • (11)
  • (1)
  • (1)
  • (24)
  • (1)
  • (4)
  • (4)
  • (1)
  • (13)
  • (1)
  • (1)
  • (2)
  • (24)
  • (3)
  • (4)
  • (2)
  • (1)
  • (10,631)
  • (397)
  • (1)
  • (12)
  • (1)
  • (8)
  • (3)
  • (2)
  • (1)
  • (1)
  • (190)
  • (55)
  • (1)
  • (6)
  • (1)
  • (63)
  • (3)
  • (15)
  • (1)
  • (12)
  • (2)
  • (1)
  • (76)
  • (5)
  • (17)
  • (19)
  • (1)
  • (14,087)
  • (2)
  • (1)
  • (1)
  • (32,198)
  • (83)
  • (468)
  • (2)
  • (1)
  • (11,566)
  • (1)
  • (1)
  • (51)
  • (3,050)
  • (6)
  • (470)
  • (104)
  • (22,741)
  • (1)
  • (4,434)
  • (1)
  • (1)
  • (1)
  • (1)
  • (16,246)
  • (1)
  • (76)
  • (18,947)
  • (139)
  • (203)
  • (3)
  • (1)
  • (62)
  • (1)
  • (1)
  • (2)
  • (28)
  • (5)
  • (1)
  • (3)
  • (10)
  • (415)
  • (2)
  • (13,812)
  • (29)
  • (1)
  • (2)
  • (45)
  • (42)
  • (11,458)
  • (1)
  • (2)
  • (8)
  • (6)
  • (2)
  • (20)
  • (2)
  • (2)
  • (54)
  • (1)
  • (2)
  • (12)
  • (20)
  • (1)
  • (34)
  • (2)
  • (1)
  • (40)
  • (2)
  • (1)
  • (62)
  • (53)
  • (453)
  • (55)
  • (10)
  • (3)
  • (78)
  • (12)
  • (11)
  • (1,196)
  • (8)
  • (9)
  • (1)
  • (20)
  • (11)
  • (1)
  • (23)
  • (3)
  • (1)
  • (3)
  • (5)
  • (2)
  • (59)
  • (95)
  • (1)
  • (1)
  • (171)
  • (211)
  • (4)
  • (127)
  • (2)
  • (1)
  • (692)
  • (13)
  • (912)
  • (1)
  • (106)
  • (2,102)
  • (114)
  • (2,514)
  • (1)
  • (12)
  • (1)
  • (1)
  • (972)
  • (1)
  • (1)
  • (1)
  • (2)
  • (6)
  • (122)
  • (1)
  • (63)
  • (3)
  • (2)
  • (3)
  • (1)
  • (1)
  • (8)
  • (1)
  • (298)
  • (1)
  • (1,815)
  • (2)
  • (1)
  • (1,791)
  • (3)
  • (1)
  • (1)
  • (1)
  • (1)
  • (14)
  • (6)
  • (16)
  • (1)
  • (23)
  • (11)
  • (12)
  • (2)
  • (1)
  • (2)
  • (2)
  • (143)
  • (33)
  • (1)
  • (41)
  • (1)
  • (19)
  • (3)
  • (4)
  • (1)
  • (1)
  • (5)
  • (1)
  • (2)
  • (153,685)
  • (54)
  • (2)
  • (3)
  • (3)
  • (133)
  • (1)
  • (1)
  • (9)
  • (1)
  • (118)
  • (1)
  • (2)
  • (4)
  • (191)
  • (1,157)
  • (10)
  • (2)
  • (10)
  • (8)
  • (2)
  • (36)
  • (1)
  • (1)
  • (1)
  • (112)
  • (12,115)
  • (680)
  • (165)
  • (1)
  • (6)
  • (1)
  • (8,396)
  • (1)
  • (16,429)
  • (3)
  • (16)
  • (4)
  • (137)
  • (31)
  • (111)
  • (1)
  • (3)
  • (8)
  • (6)
  • (9)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (1)
  • (12)
  • (1)
  • (1)
  • (30,468)
  • (13)
  • (1)
  • (32)
  • (1)
  • (1)
  • (6)
  • (79)
  • (1)
  • (1)
  • (11)
  • (7)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (24)
  • (40,282)
  • (2)
  • (1)
  • (11,815)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (40)
  • (7)
  • (57)
  • (15)
  • (1,246,451)
  • (3)
  • (1)
  • (5)
  • (16)
  • (4)
  • (1)
  • (28)
  • (548)
  • (1)
  • (11)
  • (2,475)
  • (2)
  • (1)
  • (4)
  • (2)
  • (2)
  • (421)
  • (1)
  • (8)
  • (4)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1,426)
  • (136)
  • (1)
  • (1)
  • (1)
  • (554)
  • (25)
  • (19,393)
  • (1)
  • (8)
  • (1)
  • (1)
  • (1,796)
  • (2)
  • (3)
  • (6)
  • (3)
  • (703)
  • (2)
  • (1)
  • (3)
  • (1)
  • (8)
  • (1)
  • (1)
  • (5)
  • (39)
  • (1)
  • (4)
  • (1)
  • (1)
  • (6)
  • (1)
  • (2)
  • (2,873)
  • (8)
  • (1)
  • (54)
  • (2)
  • (9)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (8)
  • (5)
  • (1)
  • (14)
  • (1)
  • (1)
  • (28)
  • (241)
  • (1)
  • (3)
  • (2)
  • (17)
  • (1)
  • (1)
  • (10)
  • (10)
  • (2)
  • (1)
  • (2)
  • (40)
  • (7)

special interests

  • (154)
  • (767)
  • (165,520)
  • (74)
  • (70,534)

Quantity

  • (1)
  • (7)
  • (2)
  • (3,051)
  • (925)
  • (1,940)
  • (4,436)
Show all

Conjugate

  • (3)
  • (3)
  • (31,220)
  • (9)
  • (1)
  • (29)
  • (2,894)
Show all

Host Species

  • (563)
  • (2,896)
  • (51)
  • (1)
  • (15)
  • (1,779)
  • (726)
Show all

Applications

  • (983)
  • (2)
  • (36)
  • (23)
  • (192)
  • (1,232)
  • (3)
Show all

Target Species

  • (79)
  • (3)
  • (2)
  • (90)
  • (40)
  • (106)
  • (492)
Show all

Classification

  • (81)
  • (105)
  • (890,871)
  • (3,641)
  • (5)
  • (758,967)
  • (30,360)
Show all

Regulatory Status

  • (336)
  • (964)
  • (1,652,617)

Isotype

  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (6)
Show all

Form

  • (2,701)
  • (2,161)
  • (1,630)
  • (14)
  • (9)
  • (18)
  • (424,199)
Show all

Molecular Weight (g/mol)

  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
Show all

Search Within Results
Keyword Search:
2,071 – 2,085 of 1,816,497 results
2,071

CD19 Rat anti-Mouse, Brilliant Ultraviolet 737, Clone: 1D3, BD Horizon™

Rat Monoclonal Antibody

Content And Storage Store undiluted at 4°C and protected from prolonged exposure to light. Do not freeze.
Target Species Mouse
Host Species Rat
Conjugate Brilliant Ultraviolet 737
Applications Flow Cytometry
Isotype IgG2a κ
Concentration 0.2mg/mL
Antigen CD19
Regulatory Status RUO
Purification Method Affinity Purified
Formulation Aqueous buffered solution containing ≤0.09% sodium azide.
Immunogen Mouse CD19 Transfected Cell Line
Classification Monoclonal
Primary or Secondary Primary
Clone 1D3
2,072

Human SOX17 APC-conjugated Antibody, R&D Systems™
GREENER_CHOICE

Goat Polyclonal Antibody has been used in 7 publications

Content And Storage Protect from light. Do not freeze. 12 months from date of receipt, 2 to 8 degreesC as supplied.
Target Species Human,Mouse
Host Species Goat
Conjugate APC
Applications Flow Cytometry,Flow Cytometry (Intracellular Staining),Immunocytochemistry,Immunohistochemistry
Isotype IgG
Gene Accession No. Q9H6I2
Antigen SOX17
Gene Symbols SOX17
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Intracellular Staining by Flow Cytometry 10 uL/10^6 cells
Gene Alias FLJ22252, SRY (sex determining region Y)-box 17, SRY-related HMG-box transcription factor SOX17, transcription factor SOX-17, VUR3
Gene ID (Entrez) 64321
Immunogen E. coli-derived recombinant human SOX17 Asp177-Val414 Accession # Q9H6I2
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Detects human SOX17 in direct ELISAs and Western blots. In direct ELISAs, less than 1% cross-reactivity with recombinant human (rh) SOX2, rhSOX6, and rhSOX15 is observed.
2,073

Human FCRN Alexa Fluor 647-conjugated Antibody, R&D Systems™
GREENER_CHOICE

Mouse Monoclonal Antibody

Content And Storage Protect from light. Do not freeze. 12 months from date of receipt, 2 to 8°C as supplied.
Target Species Human
Host Species Mouse
Conjugate Alexa Fluor 647
Applications Flow Cytometry (Intracellular Staining)
Form Supernatant
Isotype IgG2b
Gene Accession No. P55899
Antigen FCRN/FCGRT
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution Intracellular Staining by Flow Cytometry 0.25-1 μg/106 cells
Gene Alias alpha-chain, Fc fragment of IgG, receptor, transporter, alpha, FCGRT, FcRn, FcRn alpha chain, FCRNimmunoglobulin receptor, intestinal, heavy chain, IgG Fc fragment receptor transporter alpha chain, IgG receptor FcRn large subunit p51, major histocompatibility complex class I-like Fc receptor, Neonatal Fc receptor, neonatal Fc-receptor for Ig
Gene ID (Entrez) 2217.0
Formulation Supplied 0.2 mg/mL in a saline solution containing BSA and Sodium Azide.
Immunogen Chinese hamster ovary cell line CHO-derived recombinant human FCRN, Ala24-Ser297, Accession No. P55899
Classification Monoclonal
Primary or Secondary Primary
Test Specificity Detects human FCRN in direct ELISAs.
Clone 937508
2,074

Invitrogen™ Laminin Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

Content And Storage -20°C or -80°C if preferred
Target Species Human,Mouse,Rat,Rabbit,Sheep,Hamster,Mammalia,Invertebrate
Host Species Rabbit
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Free Floating),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P02468, P02469, P07942, P11047, P19137, P24043, P25391, Q60675
Isotype IgG
Concentration 1 mg/mL
Antigen Laminin
Gene Symbols LAMA1, LAMA2, LAMB1, LAMC1
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias 5830440B04; AA408497; B2e; basement membrane protein; C77966; C80098; C81607; CLM; D130003D08Rik; dy; dystrophia muscularis; LAMA; LAMA1; Lama-1; Lama2; LAMB1; Lamb-1; LAMB1; basement membrane protein; Lamb1-1; Lamb2; LAMC1; Laminin A chain; laminin alpha 2 subunit; laminin B1; laminin B1 chain; laminin B1 subunit 1; laminin B2 chain; laminin beta-1 chain; laminin gamma 1 chain; laminin M chain; laminin S; laminin subunit alpha 1; laminin subunit alpha 2; laminin subunit alpha-1; Laminin subunit alpha-2; laminin subunit beta 1; laminin subunit beta-1; laminin subunit gamma 1; laminin subunit gamma-1; laminin, alpha 1; laminin, alpha 2; laminin, beta 1; laminin, beta 2; laminin, gamma 1; laminin, gamma 1 (formerly LAMB2); laminin-1; laminin-1 subunit alpha; Laminin-1 subunit beta; laminin-1 subunit gamma; Laminin-10 subunit beta; laminin-10 subunit gamma; Laminin-11 subunit gamma; laminin-12 subunit alpha; Laminin-12 subunit beta; laminin-2 subunit alpha; Laminin-2 subunit beta; laminin-2 subunit gamma; Laminin-3 subunit alpha; laminin-3 subunit gamma; Laminin-4 subunit alpha; laminin-4 subunit gamma; Laminin-6 subunit beta; laminin-6 subunit gamma; Laminin-7 subunit gamma; laminin-8 subunit beta; Laminin-8 subunit gamma; laminin-9 subunit gamma; LAMM; LIS5; LOW QUALITY PROTEIN: laminin subunit alpha-1; LOW QUALITY PROTEIN: laminin subunit alpha-2; LOW QUALITY PROTEIN: laminin subunit beta-1; mer; merosin; merosin heavy chain; mKIAA4087; PTBHS; S-LAM alpha; S-LAM gamma; S-LAM-alpha; S-laminin subunit alpha; S-laminin subunit gamma
Gene LAMC1
Product Type Antibody
Gene ID (Entrez) 100350500, 100357482, 100358679, 100757343, 100761564, 100765555, 101102692, 101105588, 101105743, 101117424, 103346447, 117036, 16772, 16773, 16777, 226519, 284217, 298941, 309368, 316758, 3908, 3912, 3915
Formulation PBS with 50% glycerol and 0.035% sodium azide
Immunogen Laminin 111 isolated from mouse Engelbreth-Holm-Swarm (EHS) sarcoma cells.
Classification Polyclonal
Primary or Secondary Primary
2,075

Human FSHR PE-conjugated Antibody, R&D Systems™
GREENER_CHOICE

Mouse Monoclonal Antibody

Content And Storage Protect from light. Do not freeze. 12 months from date of receipt, 2 to 8 degreesC as supplied.
Target Species Human
Host Species Mouse
Conjugate R-PE
Applications Flow Cytometry
Form Purified
Isotype IgG2a
Gene Accession No. M65085
Antigen FSHR
Gene Symbols FSHR
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution Flow Cytometry 10 uL/10^6 cells
Gene Alias follicle stimulating hormone receptor, follicle-stimulating hormone receptor, Follitropin receptor, FSH R, FSH receptor, FSH-R, LGR1, LGR1FSHRO, MGC141667, MGC141668, ODG1
Gene ID (Entrez) 2492
Formulation Supplied in a saline solution containing BSA and Sodium Azide. with Sodium Azide
Immunogen NS0 mouse myeloma cell line transfected with human FSH R Accession # M65085
Classification Monoclonal
Primary or Secondary Primary
Test Specificity Detects human FSH R in direct ELISAs.
Clone 626717
2,076

GM130 Mouse, Unlabeled, Clone: 35/GM130, BD

Mouse Monoclonal Antibody

Content And Storage Store undiluted at -20°C.
Target Species Canine,Human,Mouse,Rat
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot
Isotype IgG1 κ
Research Discipline Cell Biology
Concentration 250μg/mL
Antigen GM130
Regulatory Status RUO
Purification Method Affinity Purified
Formulation Aqueous buffered solution containing BSA, glycerol, and ≤0.09% sodium azide.
Immunogen Rat GM130 aa. 869-982
Classification Monoclonal
Primary or Secondary Primary
Clone 35/GM130
2,077

LOX Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody has been used in 27 publications

Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Target Species Feline,Mouse,Human,Mouse,Pig,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin),KnockDown,Simple Western,Western Blot
Isotype IgG
Gene Accession No. P28300
Research Discipline Cancer, Cytoskeleton Markers, Endothelial Cell Markers, Extracellular Matrix, Hypoxia, Signal Transduction
Concentration 1.0 mg/ml
Antigen LOX
Gene Symbols LOX
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 0.5-4ug/ml, Simple Western 1:25, Immunohistochemistry 1:100-1:250, Immunocytochemistry/Immunofluorescence 1:100, Immunohistochemistry-Paraffin 1:100-1:250
Gene Alias lysyl oxidaseEC 1.4.3.13, MGC105112, protein-lysine 6-oxidase
Product Type Antibody
Gene ID (Entrez) 4015
Formulation Tris-Glycine and 0.15M NaCl with 0.05% Sodium Azide
Classification Polyclonal
Immunogen A synthetic peptide made to an internal region of the human LOX protein (within residues 200-300). [Swiss-Prot P28300].
Primary or Secondary Primary
Test Specificity Human and mouse. Predicted to react with rat and pig based on 100% sequence homology. Immunogen sequence has 92% homology to cow and chicken and 85% homology to Xenopus.
2,079

RB744 Rat Anti-Mouse CD19, BD Horizon™

Rat Monoclonal Antibody

Content And Storage Store undiluted at 4°C and protected from prolonged exposure to light. Do not freeze.
Target Species Mouse
Host Species Rat
Conjugate RB744
Applications Flow Cytometry
Form Liquid
Isotype IgG2a κ
Concentration 0.2 mg/mL
Antigen CD19
Regulatory Status RUO
Purification Method Affinity Chromatography
Gene Alias Cd19; CD19 antigen; B-lymphocyte antigen CD19
Gene ID (Entrez) 12478
Formulation Aqueous buffered solution containing ≤0.09% sodium azide.
Immunogen Mouse CD19 Transfected Cell Line
Classification Monoclonal
Clone 1D3
2,080

Salmonella Antibody (100/358), Alexa Fluor™ 350, R&D Systems™

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

Antigen Salmonella
Regulatory Status RUO
Content And Storage Store at 4°C in the dark.
Target Species Bacteria
Host Species Mouse
Conjugate Alexa Fluor 350
Applications ELISA,Immunocytochemistry,Immunofluorescence
Classification Monoclonal
Immunogen Native S. enteritidis (NCTC 5188 9.12:g,m).
Primary or Secondary Primary
Clone 100/358
2,081

Invitrogen™ CD44 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human,Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA,Immunohistochemistry (Paraffin),Western Blot
Form Liquid
Gene Accession No. P15379, P16070
Isotype IgG
Concentration 1.91 mg/mL
Antigen CD44
Gene Symbols CD44
Regulatory Status RUO
Purification Method Affinity Chromatography
Gene Alias AU023126; AW121933; AW146109; Bovine CD44; CD44; CD44 antigen; CD44 antigen-like protein; CD44 molecule; CD44 molecule (Indian blood group); CD44 protein; CD44 variant; CD44A; CD44-like protein; CDW44; cell surface glycoprotein CD44; Cell surface glycoprotein CD44 (hyaluronate binding protein); cell-surface glycoprotein; chondroitin sulfate proteoglycan 8; CSPG8; ECMRIII; ECMR-III; Epican; extracellular matrix receptor III; extracellular matrix receptor-III; GP90 lymphocyte homing/adhesion receptor; HCELL; hematopoietic cell E- and L-selectin ligand; heparan sulfate proteoglycan; HERMES; Hermes antigen; homing function and Indian blood group system; HUTCH-I; hyaluronan receptor; Hyaluronate receptor; IN; LHR; Ly-24; lymphocyte antigen 24; lymphocyte surface antigen precursor CD44; MC56; MDU2; MDU3; METAA; MIC4; PGP I; Pgp1; PGP-1; PGPI; PGP-I; Phagocytic glycoprotein 1; phagocytic glycoprotein I; putative Bos taurus CD44; RHAMM; sCD 44; sCD44; soluble CD 44; soluble CD44
Gene CD44
Product Type Antibody
Gene ID (Entrez) 12505, 960
Formulation PBS with 50% glycerol and 0.09% sodium azide; pH 7.3
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-178 of CD44 (NP_0006013).
Classification Polyclonal
Primary or Secondary Primary
2,082

Methicillin Resistant Staphylococcus Aureus Antibody (332/423), HRP, R&D Systems™

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

Content And Storage Store at 4°C in the dark.
Conjugate HRP
Target Species S. aureus
Host Species Mouse
Applications ELISA,Immunocytochemistry,Immunofluorescence
Isotype IgG2a κ
Antigen Methicillin Resistant Staphylococcus Aureus
Regulatory Status RUO
Purification Method Protein A or G purified
Formulation PBS with No Preservative
Classification Monoclonal
Immunogen Methicillin-resistant Staphylococcus aureus (MRSA)
Primary or Secondary Primary
Clone 332/423
2,083

Invitrogen™ SNAP Tag Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

Content And Storage -20°C
Target Species Tag
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Liquid
Isotype IgG
Concentration 1 mg/mL
Antigen SNAP Tag
Regulatory Status RUO
Purification Method Protein A/G
Product Type Antibody
Formulation BBS with no preservative; pH 8.4
Immunogen purified recombinant SNAP.
Classification Polyclonal
Primary or Secondary Primary
2,084

EAAT3 Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA,Immunocytochemistry,Immunofluorescence,Western Blot
Form Purified
Isotype IgG
Research Discipline ABC Transporters, Cell Biology, Cell Cycle and Replication, Neuronal Cell Markers, Neuroscience, Plasma Membrane Markers, Signal Transduction
Antigen EAAT3
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Gene Alias EAAC1excitatory amino acid carrier 1, EAAT3excitatory amino acid transporter 3, Excitatory amino-acid carrier 1, Neuronal and epithelial glutamate transporter, Sodium-dependent glutamate/aspartate transporter 3, solute carrier family 1 (neuronal/epithelial high affinity glutamatetransporter, system Xag), member 1, Solute carrier family 1 member 1
Product Type Antibody
Gene ID (Entrez) 6505
Formulation PBS (pH 7.3), 50% glycerol
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 430-524 of human EAAT3 (NP_004161.4).,, Sequence:, SIKPGVTQKVGEIARTGSTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEESFTAVMTTAISKNKTKEYKIVG
Classification Polyclonal
Primary or Secondary Primary
2,085

PKC epsilon Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate Unconjugated
Target Species Human
Host Species Rabbit
Applications Immunocytochemistry,Immunofluorescence
Isotype IgG
Antigen PKC epsilon
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias EC 2.7.11, EC 2.7.11.13, MGC125656, nPKC-epsilon, PKCEMGC125657, protein kinase C epsilon type, protein kinase C, epsilon
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez) 5581
Classification Polyclonal
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKR
Primary or Secondary Primary