accessibility menu, dialog, popup

UserName
Viewing profile as user:

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (1,812,594)
Primary Antibody Matched Pairs (7,138)
Protein Interaction Antibody Pairs (1,424)
Protein Phosphorylation Antibody Pairs (73)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (4)
  • (191,788)

brands

  • (2)
  • (1)
  • (1)
  • (28)
  • (2)
  • (2)
  • (971)
  • (67,047)
  • (14,167)
  • (43)
  • (6)
  • (59,912)
  • (1)
  • (110)
  • (261)
  • (2)
  • (1,311)
  • (577)
  • (2)
  • (1)
  • (11)
  • (1)
  • (1)
  • (24)
  • (1)
  • (4)
  • (4)
  • (1)
  • (13)
  • (1)
  • (1)
  • (2)
  • (24)
  • (3)
  • (4)
  • (2)
  • (1)
  • (10,632)
  • (398)
  • (1)
  • (12)
  • (1)
  • (8)
  • (3)
  • (2)
  • (1)
  • (1)
  • (190)
  • (57)
  • (1)
  • (6)
  • (1)
  • (63)
  • (3)
  • (15)
  • (1)
  • (12)
  • (2)
  • (1)
  • (76)
  • (5)
  • (17)
  • (19)
  • (1)
  • (14,088)
  • (2)
  • (1)
  • (1)
  • (30,153)
  • (83)
  • (470)
  • (2)
  • (1)
  • (11,567)
  • (1)
  • (1)
  • (51)
  • (3,052)
  • (1,122,177)
  • (6)
  • (470)
  • (105)
  • (22,741)
  • (1)
  • (4,434)
  • (1)
  • (1)
  • (1)
  • (1)
  • (16,784)
  • (1)
  • (76)
  • (18,950)
  • (139)
  • (203)
  • (3)
  • (2)
  • (62)
  • (1)
  • (1)
  • (2)
  • (28)
  • (5)
  • (1)
  • (3)
  • (10)
  • (415)
  • (2)
  • (13,814)
  • (30)
  • (1)
  • (2)
  • (45)
  • (43)
  • (14,683)
  • (1)
  • (2)
  • (8)
  • (6)
  • (2)
  • (20)
  • (2)
  • (2)
  • (55)
  • (1)
  • (2)
  • (12)
  • (20)
  • (1)
  • (34)
  • (2)
  • (1)
  • (41)
  • (2)
  • (1)
  • (62)
  • (53)
  • (487)
  • (56)
  • (10)
  • (3)
  • (78)
  • (12)
  • (11)
  • (1,197)
  • (8)
  • (9)
  • (2)
  • (20)
  • (11)
  • (1)
  • (23)
  • (3)
  • (1)
  • (3)
  • (5)
  • (2)
  • (59)
  • (95)
  • (1)
  • (1)
  • (171)
  • (212)
  • (4)
  • (127)
  • (2)
  • (1)
  • (694)
  • (13)
  • (915)
  • (1)
  • (118)
  • (2,103)
  • (116)
  • (2,514)
  • (1)
  • (12)
  • (1)
  • (1)
  • (973)
  • (1)
  • (1)
  • (1)
  • (2)
  • (6)
  • (123)
  • (1)
  • (3)
  • (2)
  • (3)
  • (1)
  • (1)
  • (8)
  • (1)
  • (300)
  • (1)
  • (1,819)
  • (2)
  • (1)
  • (1,791)
  • (3)
  • (1)
  • (1)
  • (1)
  • (1)
  • (14)
  • (6)
  • (16)
  • (1)
  • (24)
  • (11)
  • (13)
  • (2)
  • (1)
  • (2)
  • (2)
  • (143)
  • (33)
  • (1)
  • (41)
  • (1)
  • (19)
  • (3)
  • (4)
  • (1)
  • (1)
  • (5)
  • (1)
  • (2)
  • (155,591)
  • (54)
  • (2)
  • (3)
  • (3)
  • (133)
  • (1)
  • (1)
  • (11)
  • (1)
  • (118)
  • (1)
  • (2)
  • (4)
  • (193)
  • (1,160)
  • (10)
  • (2)
  • (10)
  • (8)
  • (2)
  • (37)
  • (1)
  • (1)
  • (1)
  • (112)
  • (12,115)
  • (680)
  • (166)
  • (1)
  • (6)
  • (1)
  • (8,396)
  • (1)
  • (16,518)
  • (3)
  • (16)
  • (4)
  • (137)
  • (31)
  • (112)
  • (1)
  • (3)
  • (8)
  • (6)
  • (9)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (1)
  • (1)
  • (12)
  • (1)
  • (2)
  • (30,481)
  • (13)
  • (1)
  • (32)
  • (1)
  • (1)
  • (6)
  • (79)
  • (1)
  • (1)
  • (11)
  • (7)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (23)
  • (35,349)
  • (2)
  • (1)
  • (6)
  • (12,178)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (41)
  • (7)
  • (57)
  • (15)
  • (60,221)
  • (3)
  • (1)
  • (5)
  • (16)
  • (4)
  • (1)
  • (28)
  • (548)
  • (1)
  • (11)
  • (2,475)
  • (2)
  • (1)
  • (4)
  • (2)
  • (2)
  • (426)
  • (1)
  • (8)
  • (4)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1,452)
  • (136)
  • (1)
  • (1)
  • (1)
  • (555)
  • (26)
  • (19,448)
  • (1)
  • (6)
  • (1)
  • (1)
  • (1,796)
  • (2)
  • (3)
  • (3)
  • (826)
  • (2)
  • (1)
  • (3)
  • (1)
  • (8)
  • (1)
  • (1)
  • (5)
  • (39)
  • (1)
  • (4)
  • (1)
  • (1)
  • (6)
  • (1)
  • (2)
  • (2,873)
  • (8)
  • (1)
  • (62)
  • (2)
  • (9)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (8)
  • (5)
  • (1)
  • (14)
  • (1)
  • (1)
  • (28)
  • (251)
  • (1)
  • (3)
  • (2)
  • (17)
  • (1)
  • (1)
  • (10)
  • (10)
  • (2)
  • (1)
  • (2)
  • (40)
  • (7)

special interests

  • (154)
  • (15,619)
  • (166,539)
  • (74)
  • (1,255,984)

Quantity

  • (1)
  • (7)
  • (2)
  • (3,051)
  • (925)
  • (1,939)
  • (4,405)
Show all

Classification

  • (81)
  • (105)
  • (803,023)
  • (3,641)
  • (5)
  • (726,339)
  • (32,156)
Show all

Conjugate

  • (29,851)
  • (9)
  • (1)
  • (25)
  • (2,888)
  • (74)
  • (89)
Show all

Host Species

  • (564)
  • (2,830)
  • (17)
  • (1)
  • (15)
  • (1,679)
  • (726)
Show all

Applications

  • (566)
  • (2)
  • (36)
  • (23)
  • (181)
  • (980)
  • (3)
Show all

Target Species

  • (74)
  • (2)
  • (2)
  • (66)
  • (40)
  • (101)
  • (235)
Show all

Isotype

  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (6)
Show all

Regulatory Status

  • (335)
  • (962)
  • (1,479,016)

Form

  • (2,701)
  • (2,159)
  • (1,630)
  • (14)
  • (9)
  • (21)
  • (324,282)
Show all

Molecular Weight (g/mol)

  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
Show all

Search Within Results
Keyword Search:
3,691 – 3,705 of 1,742,252 results
3,691

Invitrogen™ SOX9 Recombinant Mouse Monoclonal Antibody (GMPR9), Alexa Fluor™ Plus 488

Mouse Recombinant Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human,Mouse,Rat
Host Species Mouse
Conjugate Alexa Fluor Plus 488
Applications Flow Cytometry,Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P48436, Q04887
Isotype IgG1 κ
Concentration 1.0 mg/mL
Antigen SOX9
Gene Symbols SOX9
Regulatory Status RUO
Purification Method Protein A/G
Gene Alias 2010306G03Rik; AV220920; CMD1; CMPD1; mKIAA4243; SOX 9; Sox9; SOX-9; Sox9 transcription factor; SRA1; SRXX2; SRXY10; SRY (sex determining region Y)-box 9; SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal); SRY (sex determining region Y)-box9; SRY (sex-determining region Y)-box 9 protein; SRY box 9; SRY-box 9; SRY-Box 9 ; SRY-box containing 9; SRY-box containing gene 9; SRY-box containing protein 9; SRY-box transcription factor 9; SRY-related HMG-box, gene 9; transcription activator Sox9; transcription factor SOX-9
Gene SOX9
Product Type Antibody
Gene ID (Entrez) 140586, 20682, 6662
Formulation PBS with 0.008% Bromonitrodioxane, 0.008% Methylisothiazolone; pH 6.8
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone GMPR9
3,692

CD11a (LFA-1alpha) Monoclonal Antibody (M17/4), eFluor™ 450, eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Target Species Mouse
Host Species Rat
Conjugate eFluor 450
Applications Flow Cytometry
Form Liquid
Isotype IgG2a κ
Gene Accession No. P24063
Concentration 0.2 mg/mL
Antigen CD11a (LFA-1alpha)
Gene Symbols ITGAL
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias (p180); alpha L integrin; antigen CD11A (p180); antigen CD11A (p180), lymphocyte function-associated antigen 1, alpha polypeptide; antigen CD11A p180; CD11 antigen-like family member A; CD11a; integrin alpha L; integrin alphaL; integrin alpha-L; integrin alpha-L precursor; integrin gene promoter; integrin subunit alpha L; integrin surface receptor; integrin, alpha L; integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide); ITGAL; Leukocyte adhesion glycoprotein LFA-1 alpha chain; leukocyte function-associated molecule 1 alpha chain; LFA-1; LFA-1 alpha; LFA1A; LFA-1A; Ly-15; Ly-21; lymphocyte antigen 15; lymphocyte function associated antigen 1, alpha polypeptide; lymphocyte function-associated antigen 1; lymphocyte function-associated antigen 1, alpha polypeptide; lymphocyte function-associated antigen-1
Gene ITGAL
Product Type Antibody
Gene ID (Entrez) 16408
Classification Monoclonal
Primary or Secondary Primary
Clone M17/4
3,693

Invitrogen™ SNAP25 Recombinant Rabbit Monoclonal Antibody (1H7L4)

Rabbit Recombinant Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P60879, P60880, P60881
Isotype IgG
Concentration 0.5 mg/mL
Antigen SNAP25
Gene Symbols Snap25
Regulatory Status RUO
Purification Method Protein A
Gene Alias ALMS1; bA416N4.2; Bdr; blind drunk; CG17676; CG17884; CG40452; CMS18; dJ1068F16.2; Dmel CG40452; Dmel_CG40452; etID17571.20; etID69167.20; fj42b02; fj45g04; fj48c02; FLJ23079; GENA70; HGNC:11132; resistance to inhibitors of cholinesterase 4 homolog; RIC4; RIC-4; SEC9; si:dkeyp-8f4.6; Snap; SNAP 25; snap25; SNAP-25; snap25.1; SNAP-25.1; snap25a; SNAP-25A; SNAP-25B; snp25; sp; SUP; super protein; synaptosomal associated protein-25; synaptosomal-associated 25 kDa protein; Synaptosomal-associated protein 25; synaptosomal-associated protein 25-A; synaptosomal-associated protein, 25 kDa; synaptosomal-associated protein, 25a; synaptosomal-associated protein, 25kDa; synaptosome associated protein 25; synaptosome associated protein 25a; synaptosome associated protein 25kDa; synaptosome-associated protein 25.1; synaptosome-associated protein 25a; wu:fj42b02; wu:fj45g04; wu:fj48c02
Gene Snap25
Product Type Antibody
Gene ID (Entrez) 20614, 25012, 6616
Formulation PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen Peptides corresponding to human SNAP25 (1) aa37-aa55 2) aa168-aa186).
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone 1H7L4
3,694

CD8b Monoclonal Antibody (eBio341 (341)), Functional Grade, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C
Target Species Rat
Host Species Mouse
Conjugate Functional Grade
Applications Flow Cytometry,Functional Assay,Immunohistochemistry (Paraffin)
Form Liquid
Isotype IgG1 κ
Gene Accession No. P05541
Concentration 1 mg/mL
Antigen CD8b
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Cd8b
Product Type Antibody
Gene ID (Entrez) 24931
Formulation PBS with no preservative; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone eBio341 (341)
3,695

Invitrogen™ STARD3 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Liquid
Gene Accession No. 0
Isotype IgG
Concentration 1 mg/mL
Antigen STARD3
Gene Symbols STARD3
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias CAB1; Es64; metastatic lymph node gene 64 protein; metastatic lymph node protein 64; MLN 64; MLN64; Protein CAB1; Protein ES 64; protein MLN 64; StAR related lipid transfer domain containing 3; STARD3; StAR-related lipid transfer (START) domain containing 3; StAR-related lipid transfer domain containing 3; stAR-related lipid transfer protein 3; START domain containing 3; START domain-containing protein 3; steroidogenic acute regulatory protein related
Gene STARD3
Product Type Antibody
Gene ID (Entrez) 363675
Formulation PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen Recombinant MLN64 protein.
Classification Polyclonal
Primary or Secondary Primary
3,696

Invitrogen™ P4HA2 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot
Form Liquid
Gene Accession No. O15460, Q60716
Isotype IgG
Concentration 1 mg/mL
Antigen P4HA2
Gene Symbols P4HA2
Regulatory Status RUO
Purification Method Affinity Chromatography
Gene Alias 4-PH alpha 2; 4-PH alpha-2; 4PHalpha2; AA407196; C76437; collagen prolyl 4-hydroxylase alpha(II); C-P4Halpha(II); hypothetical protein LOC507327; P4HA2; P4hl; procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), alpha II polypeptide; procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), alpha polypeptide 2; procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), alpha polypeptide II; procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-2; prolyl 4-hydroxylase A; Prolyl 4-hydroxylase alpha IIa subunit; prolyl 4-hydroxylase subunit alpha 2; prolyl 4-hydroxylase subunit alpha-2; prolyl 4-hydroxylase, alpha polypeptide II; UNQ290/PRO330; zgc:91948
Gene P4HA2
Product Type Antibody
Gene ID (Entrez) 18452, 360526, 8974
Formulation PBS with 50% glycerol and 0.02% sodium azide; pH 7.4
Immunogen A synthesized peptide derived from human P4HA2(Accession O15460), corresponding to amino acid residues D96-D146.
Classification Polyclonal
Primary or Secondary Primary
3,697

Invitrogen™ CD21 Monoclonal Antibody (LT21), Alexa Fluor™ 647
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human,Canine,Bovine,Pig
Host Species Mouse
Conjugate Alexa Fluor 647
Applications Flow Cytometry
Form Liquid
Gene Accession No. P20023
Isotype IgG1 κ
Concentration 0.030 mg/mL
Antigen CD21
Gene Symbols CR2
Regulatory Status RUO
Purification Method Size-exclusion chromatography
Gene Alias C3b/C4b receptor; C3-binding protein; C3BR; C3DR; C4BR; CD21; CD35; CD35 antigen; cell surface receptor for C3d; complement C3b/C4b receptor 1 (Knops blood group); complement C3d receptor; Complement C3d receptor (C3DR); complement C3d receptor 2; complement component (3b/4b) receptor 1 (Knops blood group); complement component (3d/Epstein Barr virus) receptor 2; complement component 3b/4b receptor 1 (Knops blood group); complement component 3d receptor 2; complement component receptor 2; complement receptor 1 long isoform; complement receptor 2; complement receptor type 1; complement receptor type 1-like protein; complement receptor type 2; Complement Receptor type 2 (CR2); CR; CR1; Cr-1; CR1-L; Cr2; Cr-2; CVID7; EBV receptor; EBV-R; Epstein-Barr virus receptor; EVBR; expressed in B lymphocytes; KN; Knops blood group antigen; LOW QUALITY PROTEIN: complement receptor type 1; SLEB9
Gene CR2
Product Type Antibody
Gene ID (Entrez) 1380, 407126, 490269
Formulation PBS with 0.2% BSA and 15mM sodium azide
Immunogen IM9 human B-lymphoblastoid cell line.
Classification Monoclonal
Primary or Secondary Primary
Clone LT21
3,698

Invitrogen™ beta Amyloid (1-20) Monoclonal Antibody (7N22)
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage -20°C
Target Species Human,Rat
Host Species Mouse
Conjugate Unconjugated
Applications ELISA,Western Blot
Form Liquid
Gene Accession No. P05067, P08592
Isotype IgG1 κ
Concentration 0.5 mg/mL
Antigen beta Amyloid (1-20)
Gene Symbols APP
Regulatory Status RUO
Purification Method Purified
Gene Alias A4; AAA; ABETA; Abeta40; Abeta42; ABPP; AD1; Adap; AG; AICD-50; AICD-57; AICD-59; AID(50); AID(57); AID(59); Alpha-CTF; Alpha-secretase C-terminal fragment; Alzheimer disease; Alzheimer disease amyloid A4 protein homolog; alzheimer disease amyloid protein; Amyloid; amyloid A4; Amyloid b; Amyloid beta; amyloid beta (A4) precursor protein; amyloid beta (A4) precursor protein (peptidase nexin-II, Alzheimer disease); amyloid beta A4 protein; amyloid beta precursor protein; Amyloid intracellular domain 50; Amyloid intracellular domain 57; Amyloid intracellular domain 59; Amyloid precursor protein; amyloid precursor protein variant 1; amyloid precursor protein variant 2; Amyloid ß; amyloid-beta A4 protein; amyloid-beta A4 protein; amyloid beta A4 protein; Amyloid-beta precursor protein; Amyloid-beta protein 40; Amyloid-beta protein 42; Amyloidogenic glycoprotein; APP; APP-C57; APP-C59; APP-C99; APPI; appican; beta amyloid protein; beta amyloid protein precursor; beta-amyloid peptide; beta-amyloid peptide(1-40); beta-amyloid peptide(1-42); Beta-amyloid precursor protein; betaApp; Beta-APP40; Beta-APP42; Beta-CTF; Beta-secretase C-terminal fragment; C31; C80; C83; C99; Cerebral vascular amyloid peptide; CTF gamma; CTF-alpha; CTFgamma; CVAP; E030013M08Rik; Gamma-CTF(50); Gamma-CTF(57); Gamma-CTF(59); Gamma-secretase C-terminal fragment 50; Gamma-secretase C-terminal fragment 57; Gamma-secretase C-terminal fragment 59; N-APP; OTTHUMP00000096096; P3(40); P3(42); Pan-Abeta; peptidase nexin-II; PN2; PN-II; PreA4; PreA4 751; protease nexin II; protease nexin-II; S-APP-alpha; S-APP-beta; Soluble APP-alpha; Soluble APP-beta; testicular tissue protein Li 2
Gene APP
Product Type Antibody
Gene ID (Entrez) 351, 54226
Formulation PBS with 0.1% sodium azide; pH 7.2
Immunogen The immunogen used in the production of this monoclonal antibody is a chemically synthesized peptide corresponding to amino acid residues 1-20 of A-beta (beta-amyloid) peptide.
Classification Monoclonal
Primary or Secondary Primary
Clone 7N22
3,699

Invitrogen™ MX1 Monoclonal Antibody (GT4812)
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P20591
Isotype IgG2a
Concentration 1 mg/mL
Antigen MX1
Gene Symbols Mx1
Regulatory Status RUO
Purification Method Protein G
Gene Alias AI893580; GTP-binding protein; IFI78; IFI-78K; Influenza resistance protein; Interferon-induced GTP-binding protein Mx1; Interferon-induced GTP-binding protein Mx1, N-terminally processed; Interferon-induced protein p78; interferon-inducible myxovirus resistance-1 protein; interferon-inducible protein p78; interferon-regulated resistance GTP-binding protein MxA; Mx; MX dynamin like GTPase 1; MX dynamin-like GTPase 1; Mx1; Mx-1; Mx1B; Mx1-b; MxA; Myxoma resistance protein 1; myxovirus (influenza virus) resistance 1; myxovirus (influenza virus) resistance 1, interferon-inducible protein p78; myxovirus (influenza) resistance 1 polypeptide; myxovirus resistance protein 1
Gene Mx1
Product Type Antibody
Gene ID (Entrez) 4599
Formulation PBS with 20% glycerol and no preservative
Immunogen Recombinant protein encompassing a sequence within the center region of human MX1. The exact sequence is proprietary.
Classification Monoclonal
Primary or Secondary Primary
Clone GT4812
3,700

Invitrogen™ PCDH15 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Lyophilized
Gene Accession No. Q96QU1, Q99PJ1
Isotype IgG
Concentration 500 μg/mL
Antigen PCDH15
Gene Symbols PCDH15
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias Ames waltzer; av; BB078305; cadherin-related family member 15; CDHR15; DFNB23; DKFZp667A1711; ENSMUSG00000046980; Gm9815; nmf19; Pcdh15; protocadherin 15; protocadherin 15 CD2; protocadherin 15 CD3 isoform; protocadherin related 15; protocadherin-15; protocadherin-15-CD2; protocadherin-related 15; RP11-449J3.2; USH1F
Gene PCDH15
Product Type Antibody
Gene ID (Entrez) 11994, 65217, 690865
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen A synthetic peptide corresponding to a sequence of human PCDH15 (DLTVYAIDPQTNRAIDRNELFKFLDGKLLDINKDFQ).
Classification Polyclonal
Primary or Secondary Primary
3,701

Ly-6A/E (Sca-1) Monoclonal Antibody (D7), PE, eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Rat
Conjugate PE
Applications Flow Cytometry
Form Liquid
Isotype IgG2a κ
Gene Accession No. P05533, Q64253
Concentration 0.2 mg/mL
Antigen Ly-6A/E (Sca-1)
Gene Symbols Ly6a, Ly6e
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias 9804; locus A/E; Locus AE; Ly6; Ly67; Ly6a; Ly-6A.2; Ly-6A.2/Ly-6E.1; Ly6A/E; Ly-6A/E; ly6a-e; Ly6e; Ly-6E; Ly-6E.1; lymphocyte antigen 6 complex; lymphocyte antigen 6 complex, locus A; lymphocyte antigen 6 complex, locus E; lymphocyte antigen 6A-2/6E-1; Lymphocyte antigen 6E; RIG-E; Sca1; Sca-1; Sca-2; stem cell antigen 1; Stem cell antigen 2; TAP; T-cell-activating protein; thymic shared antigen 1; Tsa1; TSA-1
Product Type Antibody
Gene ID (Entrez) 110454, 17069
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone D7
3,702

Invitrogen™ Granzyme B Monoclonal Antibody (N4TL33), PE, eBioscience™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate PE
Applications Flow Cytometry
Form Liquid
Gene Accession No. P10144
Isotype IgG2a κ
Concentration 5 μL/Test
Antigen Granzyme B
Gene Symbols GZMB
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias AI553453; C11; Cathepsin G-like 1; CCP1; CCP-1/C11; CCPI; CGL1; CGL-1; CSPB; CSP-B; Ctla1; Ctla-1; CTSGL1; cytotoxic cell protease 1; cytotoxic serine protease B; Cytotoxic T lymphocyte associated serine esterase 1; cytotoxic T-lymphocyte proteinase 2; cytotoxic T-lymphocyte-associated serine esterase 1; fragmentin; fragmentin 2; fragmentin-2; GLP I; GLP III; GLP-1; granzyme 2; granzyme B; granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1); granzyme B(G,H); Granzyme-2; GranzymeB; granzyme-like protein 1; granzyme-like protein I; GRB; GZB; Gzmb; HLP; human lymphocyte protein; Human lymphocyte protein (Hlp); Lymphocyte protease; Natural killer cell protease 1; OTTHUMP00000028189; RNKP-1; SECT; T-cell serine protease 1-3E
Gene GZMB
Product Type Antibody
Gene ID (Entrez) 3002
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone N4TL33
3,703

Invitrogen™ BACE1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human,Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P56817, P56818
Isotype IgG
Concentration 1 mg/mL
Antigen BACE1
Gene Symbols BACE1
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias APP beta-secretase; asp 2; ASP2; Aspartyl protease 2; BACE; BACE 1; BACE1; BACE-1D; BACE-I-432; Beta secretase; Beta-secretase 1; beta-secretase 1 precursor variant 1; beta-site amyloid beta A4 precursor protein-cleaving enzyme; beta-site amyloid precursor protein cleaving enzyme 1; Beta-site APP cleaving enzyme 1; beta-site APP-cleaving enzyme 1; C76936; HSPC104; hypothetical protein LOC403005; KIAA1149; Memapsin; Memapsin2; Memapsin-2; membrane-associated aspartic protease 2; protease; transmembrane aspartic proteinase Asp2; zgc:77409
Gene BACE1
Product Type Antibody
Gene ID (Entrez) 23621, 23821
Formulation PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen Synthetic peptide corresponding to residues C(485) L R Q Q H D D F A D D I S L L K(501) of human beta-secretase.
Classification Polyclonal
Primary or Secondary Primary
3,704

IL-10 Monoclonal Antibody (JES3-9D7), eFluor™ 450, eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Rat
Conjugate eFluor 450
Applications Flow Cytometry
Form Liquid
Isotype IgG1 κ
Gene Accession No. P22301
Concentration 5 μL/Test
Antigen IL-10
Gene Symbols IL10
Regulatory Status RUO
Purification Method Affinity chromatography
Gene IL10
Product Type Antibody
Gene ID (Entrez) 3586
Classification Monoclonal
Primary or Secondary Primary
Clone JES3-9D7
3,705

Invitrogen™ CD162 (PSGL-1) Monoclonal Antibody (FLEG), Super Bright™ 702, eBioscience™

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate Super Bright 702
Applications Flow Cytometry
Form Liquid
Gene Accession No. Q14242
Isotype IgG2a κ
Concentration 5 μL/Test
Antigen CD162 (PSGL-1)
Gene Symbols SELPLG
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias CD162; CLA; Cutaneous lymphocyte associated antigen; cutaneous lymphocyte-associated associated antigen; leukocyte cell surface adhesion molecule; P-selectin glycoprotein ligand 1; P-selectin glycoprotein ligand 1 propeptide; P-selectin glycoprotein ligand-1; Psgl1; Psgl-1; Selectin P ligand; selectin, platelet (p-selectin) ligand; Selp1; SELPG; Selpl; SELPLG
Gene SELPLG
Product Type Antibody
Gene ID (Entrez) 6404
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone FLEG