Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

5,806 – 5,820 of 1,824,471 results

5,806

Invitrogen™ CD105 (Endoglin) Monoclonal Antibody (SN6), Brilliant Violet™ 786, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Brilliant Violet 786
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P17813
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	CD105 (Endoglin)
Gene Symbols	ENG
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI528660; AI662476; CD105; CD105 antigen; cell surface MJ7/18 antigen; Edg; END; Endo; Endoglin; endoglin (Osler-Rendu-Weber syndrome 1); Eng; HHT1; ORW; ORW1; S-endoglin; transmembrane glycoprotein
Gene	ENG
Product Type	Antibody
Gene ID (Entrez)	2022
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	SN6

5,807

Invitrogen™ AKT2 Monoclonal Antibody (4H7)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat,Monkey
Host Species	Mouse
Conjugate	Unconjugated
Applications	ChIP Assay,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P31751, P47197, Q60823
Isotype	IgG1
Concentration	1 mg/mL
Antigen	AKT2
Gene Symbols	Akt2
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	2410016A19Rik; AKT serine/threonine kinase 2; Akt2; AKT2 kinase; AW554154; HIHGHH; murine thymoma viral (v-akt) homolog-2; murine thymoma viral (v-akt) oncogene homolog 2; PKB; PKB beta; PKBB; PKBBETA; PRKBB; protein kinase Akt-2; Protein kinase B beta; protein kinase B, beta; putative v-akt murine thymoma viral oncoprotein 2; rac protein kinase beta; RAC protein kinase beta RAC-PK beta; RAC-BETA; RAC-beta serine/threonine protein kinase; RAC-beta serine/threonine-protein kinase; RAC-PK-beta; thymoma viral proto-oncogene 2; v-akt murine thymoma viral oncogene homolog 2
Gene	Akt2
Product Type	Antibody
Gene ID (Entrez)	11652, 208, 25233
Formulation	PBS with 1mg/mL BSA, 30% glycerol and 0.05% sodium azide
Immunogen	Full length human recombinant protein of human AKT2 (NP_001617) produced in HEK293T cell.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	4H7

5,808

Invitrogen™ HLA-DR Recombinant Mouse Monoclonal Antibody (LN3)

Mouse Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P01903, P01911, P04233, P13762, P79483, Q30154
Isotype	IgG2b κ
Concentration	1 mg/mL
Antigen	HLA-DR
Gene Symbols	CD74, HLA-DRA, HLA-DRB1, HLA-DRB3, HLA-DRB4, HLA-DRB5
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	AI323765; BLA-DRB3; BOLA-DRA; BoLA-DR-alpha; BoLA-DRB; BOLA-DRB3; BoLA-DRB3 protein; BoLA-DRB3.2; Bota-DRB01; Bota-DRB02; Bota-DRB04; Bota-DRB07; Bota-DRB21; Bota-DRB22; bovine leukocyte antigen; Cd74; CD74 antigen; CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated); CD74 molecule; Cd74 molecule, major histocompatibility complex, class II invariant chain; class II-associated invariant chain peptide; CLIP; Clone P2-beta-3; DASS-397D15.1; DHLAG; dinucleotide microsatellite; DLA class II histocompatibility antigen, DR-1 beta chain; DLA DRBB1 beta chain; DLA-DR beta; DLA-DRB1; DLA-DRBB1; DR beta-5; DR beta-chain antigen binding domain; DR-16; DR2-beta-2; DR4; DR-4; DR7; DR9; DR-9; DRB; DRB1; DRB1 transplantation antigen; DRB3; DRB4; DRBB1; DR-beta chain; DR-beta chain MHC class II; DRw10; Dw2; DW2.2/DR2.2; E-alpha-f; FLJ51114; FLJ75017; FLJ76359; gamma chain of class II antigens; H-2 class II histocompatibility antigen gamma chain; H-2 class II histocompatibility antigen, E-D alpha chain; H-2 class II histocompatibility antigen, E-K alpha chain; H-2 class II histocompatibility antigen, E-U alpha chain; H-2Ea; H2-Ea; H2-Ea-ps; H2-IE-alpha; histocompatibility 2, class II antigen E alpha; histocompatibility 2, class II antigen E alpha, pseudogene; histocompatibility antigen HLA-DR alpha; histocompatibility complex, class II, DR beta 3; histocompatibility: class II antigens, gamma chain of; HLA class II histocompatibility antigen gamma chain; HLA class II histocompatibility antigen, DR alpha chain; HLA class II histocompatibility antigen, DR beta 3 chain; HLA class II histocompatibility antigen, DR beta 4 chain; HLA class II histocompatibility antigen, DR beta 5 chain; HLA class II histocompatibility antigen, DR-1 beta chain; HLA class II histocompatibility antigen, DR-5 beta chain; HLA class II histocompatibility antigen, DRB1-15 beta chain; HLA class II histocompatibility antigen, DRB1-16 beta chain; HLA class II histocompatibility antigen, DRB1-3 chain; HLA class II histocompatibility antigen, DRB1-7 beta chain; HLA class II histocompatibility antigen, DRB1-9 beta chain; HLADG; HLA-DR antigens-associated invariant chain; HLA-DR1B; HLA-DR3B; HLA-DR4B; HLA-DRA; HLA-DRA1; HLA-DRB; HLA-DRB1; HLA-DRB2; HLA-DRB3; HLA-DRB4; HLA-DRB5; HLA-DR-gamma; human leucocyte antigen DRB1; human leucocyte antigen DRB3; human leucocyte antigen DRB4; human leucocyte antigen DRB5; ia antigen-associated invariant chain; Ia3; Ia-3; Ia-associated invariant chain; Ia-GAMMA; I-E alpha MHC class II; I-Ealpha; II; integral membrane glycoprotein; invariant gamma chain; invariant polypeptide of major histocompatibility complex, class II antigen-associated; INVG34; LA-DRB; leukocyte antigen; leukocyte antigen class II; leukocyte antigen DRB3; lymphocyte antigen DRB1; major histocompatibility complex class II DR-beta chain; major histocompatibility complex, class II, DR alpha; major histocompatibility complex, class II, DR alpha precursor; major histocompatibility complex, class II, DR beta 1; major histocompatibility complex, class II, DR beta 3; major histocompatibility complex, class II, DR beta 4; major histocompatibility complex, class II, DR beta 4 precursor; major histocompatibility complex, class II, DR beta 5; major histocompatibility complex, class II, DRB3; MHC cell surface glycoprotein; MHC class I antigen; MHC class II antigen; MHC class II antigen beta chain; MHC class II antigen BoLA-DRB3; MHC class II antigen DR beta 3 chain; MHC class II antigen DRA; MHC class II antigen DRB115; MHC class II antigen DRB116; MHC class II antigen DRB13; MHC class II antigen DRB19; MHC class II antigen DRB3; MHC class II antigen DRB4; MHC class II antigen DRB5; MHC class II antigen E alpha; MHC class II antigen HLA-DR-beta; MHC class II DLA DRB1 beta chain; MHC class II DLA-DRB; MHC class II DLA-DR-beta-1; MHC class II DR beta 1; MHC class II DR beta chain; MHC class II DR beta-chain
Gene	HLA-DRB4
Product Type	Antibody
Gene ID (Entrez)	3122, 3123, 3125, 3126, 3127, 972
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	LN3

5,809

Invitrogen™ PNPase Recombinant Rabbit Monoclonal Antibody (24H24L10)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry,Western Blot
Form	Liquid
Gene Accession No.	Q8TCS8
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	PNPase
Gene Symbols	PNPT1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	1200003F12Rik; 3'-5' RNA exonuclease OLD35; COXPD13; DFNB70; DKFZp762K1914; old 35; Old35; old-35; PNPase; PNPase 1; PNPase old-35; Pnpt1; Pnptl1; polynucleotide phosphorylase 1; Polynucleotide phosphorylase-like protein; polyribonucleotide nucleotidyltransferase 1; polyribonucleotide nucleotidyltransferase 1, mitochondrial
Gene	PNPT1
Product Type	Antibody
Gene ID (Entrez)	87178
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Protein corresponding to human PNPase [aa46-aa669].
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	24H24L10

5,810

Invitrogen™ Phospho-Tau (Thr181) Recombinant Superclonal™ Antibody (5HCLC)

Rabbit Recombinant Superclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P10636, P10637, P19332
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	Phospho-Tau (Thr181)
Gene Symbols	MAPT
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	AI413597; AW045860; DDPAC; FLJ31424; FTDP17; FTDP-17; G protein beta1/gamma2 subunit-interacting factor 1; map tau; Mapt; MAPTL; MGC138549; microtubule associated protein tau; microtubule-associated protein tau; microtubule-associated protein tau, isoform 4; microtubules; MSTD; Mtapt; MTBT1; MTBT2; Neurofibrillary tangle protein; neurofibrillary tangles; Neuronal Marker; paired helical filament-tau; PHFtau; PHF-tau; PPND; PPP1R103; protein phosphatase 1, regulatory subunit 103; pTau; RNPTAU; Tau; Tau microtubule-associated protein; tau protein; Tau-4; Tau5; Unknown (protein for MGC:134287)
Gene	MAPT
Product Type	Antibody
Gene ID (Entrez)	17762, 29477, 4137
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	human Tau around phosphorylated Tyrosine 181.
Classification	Recombinant Superclonal
Primary or Secondary	Primary
Clone	5HCLC

5,811

IL-22 Monoclonal Antibody (22URTI), Brilliant Ultra Violet™ 661, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Brilliant Ultraviolet 661
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	Q9GZX6
Concentration	5 μL/Test
Antigen	IL-22
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Cytokine Zcyto18; EGK_03903; il 22; IL-10-related T-cell-derived inducible factor; IL-10-related T-cell-derived-inducible factor; IL-21; IL22; IL-22; Il22a; IL-22a; IL-D110; ILN; ILTIF; IL-TIF; ILTIF alpha; IL-TIF alpha; ILTIFa; Interleukin; interleukin 10-related T cell-derived inducible factor; interleukin 22; Interleukin22; interleukin-22; Interleukin-22a; RGD1561292; TIFa; TIFIL-23; UNQ3099/PRO10096; ZCYTO18
Gene	IL22
Product Type	Antibody
Gene ID (Entrez)	50616
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	22URTI

5,812

Invitrogen™ CRB1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P82279, Q8VHS2
Isotype	IgG
Concentration	500 μg/mL
Antigen	CRB1
Gene Symbols	CRB1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	CRB1; crumbs 1, cell polarity complex component; crumbs family member 1, photoreceptor morphogenesis associated; Crumbs homolog 1; LCA8; Protein crumbs homolog 1; RP12
Gene	CRB1
Product Type	Antibody
Gene ID (Entrez)	170788, 23418, 304825
Formulation	PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence of human CRB1 (FRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQ).
Classification	Polyclonal
Primary or Secondary	Primary

5,813

Invitrogen™ HDAC4 Monoclonal Antibody (7E2E6)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P56524, Q6NZM9
Isotype	IgG1
Concentration	1 mg/mL
Antigen	HDAC4
Gene Symbols	HDAC4
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	4932408F19Rik; AHO3; AI047285; BDMR; DKFZp779K1053; HA6116; HD4; HD7; HD7b; HD9; HDAC; HDAC4; HDAC-4; HDAC7; HDAC7B; HDAC9; HDAC9B; HDAC9FL; HDACA; HDAC-A; HDRP; Histone deacetylase 4; histone deacetylase A; KIAA0288; KIAA0744; MITR
Gene	HDAC4
Product Type	Antibody
Gene ID (Entrez)	208727, 9759
Formulation	PBS with 0.05% sodium azide
Immunogen	Purified recombinant fragment of human HDAC4 (aa: 456-592) expressed in E. Coli.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	7E2E6

5,814

KLRG1 Monoclonal Antibody (2F1), Alexa Fluor™ 488, eBioscience™, Invitrogen™

Syrian Hamster Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Syrian Hamster
Conjugate	Alexa Fluor 488
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG
Gene Accession No.	O88713
Antigen	KLRG1
Gene Symbols	Klrg1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene	Klrg1
Product Type	Antibody
Gene ID (Entrez)	50928
Classification	Monoclonal
Primary or Secondary	Primary
Clone	2F1

5,815

Invitrogen™ TLR9 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q9EQU3, Q9NR96
Isotype	IgG
Concentration	1 mg/mL
Antigen	TLR9
Gene Symbols	Tlr9
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	CD289; Tlr9; toll like receptor 9; toll-like receptor 9; UNQ5798/PRO19605
Gene	Tlr9
Product Type	Antibody
Gene ID (Entrez)	338457, 54106, 81897
Formulation	PBS with 0.02% sodium azide
Immunogen	A peptide corresponding to 15 amino acids near the center of human TLR9.
Classification	Polyclonal
Primary or Secondary	Primary

5,816

Invitrogen™ CD105 (Endoglin) Monoclonal Antibody (SN6), Brilliant Violet™ 421, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Brilliant Violet 421
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P17813
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	CD105 (Endoglin)
Gene Symbols	ENG
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI528660; AI662476; CD105; CD105 antigen; cell surface MJ7/18 antigen; Edg; END; Endo; Endoglin; endoglin (Osler-Rendu-Weber syndrome 1); Eng; HHT1; ORW; ORW1; S-endoglin; transmembrane glycoprotein
Gene	ENG
Product Type	Antibody
Gene ID (Entrez)	2022
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	SN6

5,817

CD278 (ICOS) Monoclonal Antibody (C398.4A), Functional Grade, eBioscience™, Invitrogen™

Armenian Hamster Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Mouse,Rat,Rhesus Macaque
Host Species	Armenian Hamster
Conjugate	Functional Grade
Applications	Flow Cytometry,Functional Assay
Form	Liquid
Isotype	IgG
Gene Accession No.	Q9R1T7, Q9WVS0
Concentration	1 mg/mL
Antigen	CD278 (ICOS)
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Activation-inducible lymphocyte immunomediatory molecule; Ailim; CCLP; CD278; CD28 and CTLA-4-like protein; CD28-related protein 1; CRP-1; CVID1; H4; Icos; inducible costimulator; inducible T cell costimulator; inducible T cell co-stimulator; inducible T-cell costimulator; inducible T-cell co-stimulator; Ly115
Gene	ICOS
Product Type	Antibody
Gene ID (Entrez)	54167, 64545, 705788
Formulation	PBS with no preservative; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	C398.4A

5,818

Invitrogen™ TCR alpha/beta Monoclonal Antibody (IP26), Brilliant Ultra Violet™ 563, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Brilliant Ultraviolet 563
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P01848, P04435, P0DSE1, P0DSE2
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	TCR alpha/beta
Gene Symbols	TRA, TRAC, TRB, TRBV7-9
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	FLJ22602; IMD7; LOC290071; MGC117436; MGC22624; MGC23964; MGC71411; RATTCB; RATTCBC1; RGD1359684; similar to RIKEN cDNA A430107P09 gene; T cell receptor beta locus; T3/TCR complex; TCB; TCBC1; t-cell antigen receptor; T-cell receptor alpha constant; T-cell receptor beta chain; T-cell receptor V alpha; tcr alpha; TCR alpha/ beta; TCR beta; TCRA; Tcrb; TRA; Tra29; TRAC; TRB; TRB@; TRCA
Gene	TRAC
Product Type	Antibody
Gene ID (Entrez)	28589, 28755, 6955, 6957
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	IP26

5,819

CD122 Monoclonal Antibody (TM-b1 (TM-beta1)), FITC, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	FITC
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2b κ
Gene Accession No.	P16297
Concentration	0.5 mg/mL
Antigen	CD122
Gene Symbols	Il2rb
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CD122; CD122 antigen; high affinity IL-2 receptor beta subunit; high affinity IL-2 receptor subunit beta; IL-15 receptor beta chain; IL15RB; IL15Rbeta; IL-15Rbeta; IL-2 receptor beta chain; IL-2 receptor subunit beta; IL-2/15 receptor-beta; Il-2/15Rbeta; IL-2R subunit beta; IL2RB; IL-2RB; IL2RBC; Il-2Rbeta; interleukin 15 receptor, beta; interleukin 2 receptor subunit beta; interleukin 2 receptor, beta; interleukin 2 receptor, beta chain; Interleukin-15 receptor subunit beta; Interleukin-2 receptor subunit beta; p70; p70-75; p75
Gene	Il2rb
Product Type	Antibody
Gene ID (Entrez)	16185
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	TM-b1 (TM-beta1)

5,820

CD235a (Glycophorin A) Monoclonal Antibody (10F7MN), Brilliant Ultra Violet™ 737, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Brilliant Ultraviolet 737
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P02724
Concentration	5 μL/Test
Antigen	CD235a (Glycophorin A)
Gene Symbols	GYPA
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI853584; CD235; CD235a; erythroid-lineage-specific membrane sialoglycoprotein; glycophorin A; glycophorin A (MN blood group); glycophorin A (MNS blood group); glycophorin A, GPA; glycophorin Erik; glycophorin MiI; glycophorin MiV; glycophorin SAT; glycophorin Sta type C; glycophorin-A; GPA; GPErik; GPSAT; Gypa; HGNC:4702; HGpMiV; HGpMiX; HGpMiXI; HGpSta(C); HGpStaC; Mi.V glycoprotein; Mi.V glycoprotein (24 AA); MN; MN sialoglycoprotein; MNS; PAS-2; recombinant glycophorin A-B Miltenberger-DR; sialoglycoprotein alpha
Gene	GYPA
Product Type	Antibody
Gene ID (Entrez)	2993
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	10F7MN

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ CD105 (Endoglin) Monoclonal Antibody (SN6), Brilliant Violet™ 786, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ AKT2 Monoclonal Antibody (4H7) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

IL-22 Monoclonal Antibody (22URTI), Brilliant Ultra Violet™ 661, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CRB1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ HDAC4 Monoclonal Antibody (7E2E6) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

KLRG1 Monoclonal Antibody (2F1), Alexa Fluor™ 488, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TLR9 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD105 (Endoglin) Monoclonal Antibody (SN6), Brilliant Violet™ 421, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD122 Monoclonal Antibody (TM-b1 (TM-beta1)), FITC, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD235a (Glycophorin A) Monoclonal Antibody (10F7MN), Brilliant Ultra Violet™ 737, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD105 (Endoglin) Monoclonal Antibody (SN6), Brilliant Violet™ 786, eBioscience™

Invitrogen™ AKT2 Monoclonal Antibody (4H7)

IL-22 Monoclonal Antibody (22URTI), Brilliant Ultra Violet™ 661, eBioscience™, Invitrogen™

Invitrogen™ CRB1 Polyclonal Antibody

Invitrogen™ HDAC4 Monoclonal Antibody (7E2E6)

KLRG1 Monoclonal Antibody (2F1), Alexa Fluor™ 488, eBioscience™, Invitrogen™

Invitrogen™ TLR9 Polyclonal Antibody

Invitrogen™ CD105 (Endoglin) Monoclonal Antibody (SN6), Brilliant Violet™ 421, eBioscience™

CD122 Monoclonal Antibody (TM-b1 (TM-beta1)), FITC, eBioscience™, Invitrogen™

CD235a (Glycophorin A) Monoclonal Antibody (10F7MN), Brilliant Ultra Violet™ 737, eBioscience™, Invitrogen™