accessibility menu, dialog, popup

UserName
Viewing profile as user:

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (1,874,874)
Primary Antibody Matched Pairs (7,117)
Protein Interaction Antibody Pairs (1,459)
Protein Phosphorylation Antibody Pairs (73)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (4)
  • (191,788)

brands

  • (2)
  • (1)
  • (1)
  • (28)
  • (2)
  • (2)
  • (971)
  • (76,937)
  • (14,167)
  • (43)
  • (6)
  • (59,912)
  • (1)
  • (110)
  • (261)
  • (2)
  • (1,311)
  • (577)
  • (2)
  • (1)
  • (11)
  • (1)
  • (1)
  • (24)
  • (1)
  • (4)
  • (4)
  • (1)
  • (13)
  • (1)
  • (1)
  • (2)
  • (24)
  • (3)
  • (4)
  • (2)
  • (1)
  • (10,632)
  • (398)
  • (1)
  • (12)
  • (1)
  • (8)
  • (3)
  • (2)
  • (1)
  • (1)
  • (190)
  • (57)
  • (1)
  • (6)
  • (1)
  • (63)
  • (3)
  • (15)
  • (1)
  • (12)
  • (2)
  • (1)
  • (76)
  • (5)
  • (17)
  • (19)
  • (1)
  • (14,087)
  • (2)
  • (1)
  • (1)
  • (30,153)
  • (83)
  • (469)
  • (2)
  • (1)
  • (11,566)
  • (1)
  • (1)
  • (51)
  • (3,052)
  • (6)
  • (470)
  • (104)
  • (22,740)
  • (1)
  • (4,434)
  • (1)
  • (1)
  • (1)
  • (1)
  • (16,226)
  • (1)
  • (76)
  • (18,950)
  • (139)
  • (203)
  • (3)
  • (62)
  • (1)
  • (1)
  • (2)
  • (28)
  • (5)
  • (1)
  • (3)
  • (10)
  • (415)
  • (2)
  • (13,812)
  • (29)
  • (1)
  • (2)
  • (45)
  • (43)
  • (14,683)
  • (1)
  • (2)
  • (8)
  • (6)
  • (2)
  • (20)
  • (2)
  • (2)
  • (55)
  • (1)
  • (2)
  • (12)
  • (20)
  • (1)
  • (34)
  • (2)
  • (1)
  • (41)
  • (2)
  • (1)
  • (62)
  • (53)
  • (487)
  • (56)
  • (10)
  • (3)
  • (78)
  • (12)
  • (11)
  • (1,197)
  • (8)
  • (9)
  • (2)
  • (20)
  • (11)
  • (1)
  • (23)
  • (3)
  • (1)
  • (3)
  • (5)
  • (2)
  • (59)
  • (95)
  • (1)
  • (1)
  • (171)
  • (212)
  • (4)
  • (127)
  • (2)
  • (1)
  • (694)
  • (13)
  • (912)
  • (1)
  • (109)
  • (2,103)
  • (114)
  • (2,514)
  • (1)
  • (12)
  • (1)
  • (1)
  • (973)
  • (1)
  • (1)
  • (1)
  • (2)
  • (6)
  • (123)
  • (1)
  • (63)
  • (3)
  • (2)
  • (3)
  • (1)
  • (1)
  • (8)
  • (1)
  • (300)
  • (1)
  • (1,818)
  • (2)
  • (1)
  • (1,785)
  • (3)
  • (1)
  • (1)
  • (1)
  • (1)
  • (14)
  • (6)
  • (16)
  • (1)
  • (24)
  • (11)
  • (13)
  • (2)
  • (1)
  • (2)
  • (2)
  • (143)
  • (33)
  • (1)
  • (41)
  • (1)
  • (19)
  • (3)
  • (4)
  • (1)
  • (1)
  • (5)
  • (1)
  • (2)
  • (155,272)
  • (54)
  • (2)
  • (3)
  • (3)
  • (133)
  • (1)
  • (1)
  • (9)
  • (1)
  • (118)
  • (1)
  • (2)
  • (4)
  • (193)
  • (1,160)
  • (10)
  • (2)
  • (10)
  • (8)
  • (2)
  • (36)
  • (1)
  • (1)
  • (1)
  • (112)
  • (12,116)
  • (680)
  • (166)
  • (1)
  • (6)
  • (1)
  • (8,396)
  • (1)
  • (16,517)
  • (3)
  • (16)
  • (4)
  • (137)
  • (31)
  • (112)
  • (1)
  • (3)
  • (8)
  • (6)
  • (9)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (1)
  • (1)
  • (12)
  • (1)
  • (2)
  • (30,477)
  • (13)
  • (1)
  • (32)
  • (1)
  • (1)
  • (6)
  • (79)
  • (1)
  • (1)
  • (11)
  • (7)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (23)
  • (35,348)
  • (1)
  • (6)
  • (12,178)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (41)
  • (7)
  • (57)
  • (15)
  • (1,236,022)
  • (3)
  • (1)
  • (5)
  • (16)
  • (4)
  • (1)
  • (28)
  • (548)
  • (1)
  • (11)
  • (2,474)
  • (2)
  • (1)
  • (4)
  • (2)
  • (2)
  • (426)
  • (1)
  • (8)
  • (4)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1,452)
  • (136)
  • (1)
  • (1)
  • (1)
  • (555)
  • (19,411)
  • (1)
  • (8)
  • (1)
  • (1)
  • (1,796)
  • (2)
  • (3)
  • (6)
  • (3)
  • (704)
  • (2)
  • (1)
  • (3)
  • (1)
  • (8)
  • (1)
  • (1)
  • (5)
  • (39)
  • (1)
  • (4)
  • (1)
  • (1)
  • (6)
  • (1)
  • (2)
  • (2,873)
  • (8)
  • (1)
  • (52)
  • (2)
  • (9)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (8)
  • (5)
  • (1)
  • (14)
  • (1)
  • (1)
  • (28)
  • (251)
  • (1)
  • (3)
  • (2)
  • (17)
  • (1)
  • (1)
  • (10)
  • (10)
  • (2)
  • (1)
  • (2)
  • (40)
  • (7)

special interests

  • (154)
  • (13,404)
  • (166,445)
  • (71)
  • (73,825)

Quantity

  • (1)
  • (7)
  • (2)
  • (3,051)
  • (925)
  • (1,939)
  • (4,412)
Show all

Conjugate

  • (31,135)
  • (9)
  • (1)
  • (25)
  • (2,888)
  • (74)
  • (89)
Show all

Host Species

  • (561)
  • (2,902)
  • (17)
  • (1)
  • (15)
  • (1,776)
  • (726)
Show all

Classification

  • (81)
  • (105)
  • (884,793)
  • (3,641)
  • (5)
  • (754,096)
  • (31,926)
Show all

Applications

  • (571)
  • (2)
  • (36)
  • (23)
  • (187)
  • (1,232)
  • (3)
Show all

Target Species

  • (74)
  • (3)
  • (2)
  • (84)
  • (40)
  • (106)
  • (478)
Show all

Isotype

  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (6)
Show all

Regulatory Status

  • (335)
  • (964)
  • (1,606,521)

Form

  • (2,701)
  • (2,159)
  • (1,630)
  • (14)
  • (9)
  • (18)
  • (420,148)
Show all

Research Discipline

  • (1)
  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
Show all

Search Within Results
Keyword Search:
7,126 – 7,140 of 1,804,647 results
7,126

Invitrogen™ BMP5 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA,Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form Lyophilized
Gene Accession No. P22003, P49003
Isotype IgG
Concentration 500 μg/mL
Antigen BMP5
Gene Symbols Bmp5
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias AU023399; BMP; BMP 5; Bmp5; BMP-5; bone morphogenenic protein-5; Bone morphogenetic protein; bone morphogenetic protein 5; MGC34244; se; short ear
Gene Bmp5
Product Type Antibody
Gene ID (Entrez) 12160, 315824, 653
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL).
Classification Polyclonal
Primary or Secondary Primary
7,127

Invitrogen™ SLIT2 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot,Western Blot
Form Liquid
Gene Accession No. O94813, Q9R1B9, Q9WVC1
Isotype IgG
Concentration 0.41 mg/mL
Antigen SLIT2
Gene Symbols SLIT2
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias downregulated during adipocyte differentiation-1; Drad-1; E030015M03Rik; E130320P19Rik; mKIAA4141; neurogenic extracellular slit protein; SLIL3; Slit; slit guidance ligand 2; slit homolog 2 (Drosophila); slit homolog 2 protein; Slit homolog 2 protein C-product; Slit homolog 2 protein N-product; SLIT2; Slit-2; Slit2 protein
Gene SLIT2
Product Type Antibody
Gene ID (Entrez) 20563, 360272, 9353
Formulation PBS with 20% glycerol, 1% BSA and 0.025% ProClin 300; pH 7
Immunogen Recombinant protein encompassing a sequence within the center region of human SLIT2. The exact sequence is proprietary.
Classification Polyclonal
Primary or Secondary Primary
7,128

SSEA4 Monoclonal Antibody (eBioMC-813-70 (MC-813-70)), Alexa Fluor™ 488, eBioscience™, Invitrogen™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human,Mouse,Canine,Rabbit,Monkey,Chicken
Host Species Mouse
Conjugate Alexa Fluor 488
Applications Flow Cytometry
Form Liquid
Isotype IgG3
Concentration 5 μL/Test
Antigen SSEA4
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias SSEA-4; stage-specific embryonic antigen 4
Product Type Antibody
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone eBioMC-813-70 (MC-813-70)
7,129

Invitrogen™ n-Myc Monoclonal Antibody (NCM-II 100)
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot
Form Liquid
Gene Accession No. P04198
Isotype IgG1
Concentration 1 mg/mL
Antigen n-Myc
Gene Symbols MYCN
Regulatory Status RUO
Purification Method Protein A
Gene Alias Avian myelocytomatosis viral (v-myc) related oncogene neuroblastoma derived (Nmyc); Avian myelocytomatosis viral (v-myc) related oncogene, neuroblastoma derived (Nmyc); BHLHE37; Class E basic helix-loop-helix protein 37; c-nmyc; fb57a02; MODED; Mycn; mycn protein; MYCN proto-oncogene, bHLH transcription factor; neuroblastoma MYC oncogene; neuroblastoma myc-related oncogene 1; neuroblastoma-derived v-myc avian myelocytomatosis viral related oncogene; Nmuc1; NMYC; N-myc; N-myc protein; N-myc proto-oncogene protein; Nmyc1; Nmyc-1; N-myc-like protein; ODED; oncogene NMYC; oncogene pp65/67; pp65/67; v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog; v-myc myelocytomatosis viral related oncogene, neuroblastoma derived; v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian); wu:fb57a02; zgc:85706
Gene MYCN
Product Type Antibody
Gene ID (Entrez) 4613
Formulation PBS with 1mg/mL BSA, 30% glycerol and 0.05% sodium azide; pH 7.2-7.4
Immunogen human fusion protein.
Classification Monoclonal
Primary or Secondary Primary
Clone NCM-II 100
7,130

Invitrogen™ CD45R (B220) Monoclonal Antibody (HIS24), Biotin, eBioscience™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Rat
Host Species Mouse
Conjugate Biotin
Applications Flow Cytometry
Form Liquid
Gene Accession No. P04157
Isotype IgG2b κ
Concentration 0.5 mg/mL
Antigen CD45R (B220)
Gene Symbols PTPRC
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias B220; Cd45; CD45 antigen; CD45R; GP180; Lca; L-CA; leucocyte common antigen; leukocyte common antigen; leukocyte common antigen A; leukocyte common antigen B; loc; LY5; Ly-5; Lymphocyte antigen 5; lymphocyte common antigen; Lyt-4; membrane tyrosine phosphatase; protein tyrosine phosphatase receptor type C; protein tyrosine phosphatase, receptor type C; protein tyrosine phosphatase, receptor type, C; protein tyrosine phosphatase, receptor type, c polypeptide; Protein tyrosine phosphatase, receptor-type, c polypeptide; Ptprc; Receptor-type tyrosine-protein phosphatase C; RT7; T200; T200 glycoprotein; T200 leukocyte common antigen
Gene PTPRC
Product Type Antibody
Gene ID (Entrez) 24699
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone HIS24
7,131

CD62L (L-Selectin) Monoclonal Antibody (DREG-56 (DREG56)), Brilliant Ultra Violet™ 737, eBioscience™, Invitrogen™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Target Species Human
Host Species Mouse
Conjugate Brilliant Ultraviolet 737
Applications Flow Cytometry
Form Liquid
Isotype IgG1 κ
Gene Accession No. P14151
Concentration 5 μL/Test
Antigen CD62L (L-Selectin)
Gene Symbols SELL
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias A.11; AI528707; CD62 antigen-like family member L; CD62L; gp90-MEL; hLHRc; LAM1; LAM-1; LECAM1; LECAM-1; LEU8; Leu-8; Leukocyte adhesion molecule 1; leukocyte surface antigen Leu-8; Leukocyte-endothelial cell adhesion molecule 1; LNHR; LSEL; L-selectin; Ly22; Ly-22; LYAM1; Lyam-1; Ly-m22; Lymph node homing receptor; lymphocyte adhesion molecule 1; lymphocyte antigen 22; Lymphocyte surface MEL-14 antigen; pln homing receptor; PLNHR; SELE; selectin E (endothelial adhesion molecule 1); selectin L; selectin L (lymphocyte adhesion molecule 1); selectin, lymphocyte; Sell; TQ1
Gene SELL
Product Type Antibody
Gene ID (Entrez) 6402
Classification Monoclonal
Primary or Secondary Primary
Clone DREG-56 (DREG56)
7,132

IL-17A Monoclonal Antibody (eBio17B7), Brilliant Ultra Violet™ 661, eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse,Rat
Host Species Rat
Conjugate Brilliant Ultraviolet 661
Applications Flow Cytometry
Form Liquid
Isotype IgG2a κ
Gene Accession No. Q61453, Q62386
Concentration 0.2 mg/mL
Antigen IL-17A
Gene Symbols IL17A
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias Ctla8; CTLA-8; cytokine; cytotoxic T-lymphocyte-associated antigen 8; cytotoxic T-lymphocyte-associated protein 8; il 17; Il17; IL-17; IL17A; IL-17a; ILN; Interleukin; interleukin 17; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); interleukin 17 precursor; interleukin 17A; interleukin-17; Interleukin17A; interleukin-17A; R-IL-17-A
Gene IL17A
Product Type Antibody
Gene ID (Entrez) 16171, 301289
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone eBio17B7
7,133

Invitrogen™ CD178 (Fas Ligand) Monoclonal Antibody (MFL3), Super Bright™ 600, eBioscience™
GREENER_CHOICE

Armenian Hamster Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Armenian Hamster
Conjugate Super Bright 600
Applications Flow Cytometry
Form Liquid
Gene Accession No. P41047
Isotype IgG
Concentration 0.2 mg/mL
Antigen CD178 (Fas Ligand)
Gene Symbols Fasl
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias ADAM10-processed FasL form; ALPS1B; APL; Apoptosis (APO 1) antigen ligand 1; apoptosis (APO-1) antigen ligand 1; Apoptosis (APO-1) antigen ligand 1 (Fas antigen ligand); apoptosis antigen ligand; APT1LG1; APTL; CD178; CD178 antigen; CD95 ligand; CD95 ligand protein;Generalized lymphoproliferative disease (Gld); Cd95l; CD95-L; CD95L protein; fas antigen ligand; Fas ligand; Fas ligand (TNF superfamily, member 6); Fasl; Fas-L; FasL ICD; FasL intracellular domain; Faslg; Fas-LG; generalized lymphoproliferative disease; gld; mutant tumor necrosis factor family member 6; Receptor-binding FasL ectodomain; sFasL; Soluble Fas ligand; soluble form; SPA; SPPL2A-processed FasL form; TNFL; Tnfsf6; TNLG1A; Tumor necrosis factor (ligand) superfamily member 6; Tumor necrosis factor (ligand) superfamily member 6 (apoptosis (APO-1) antigen ligand 1) (Fas antigen ligand); Tumor necrosis factor (ligand) superfamily, member 6 (apoptosis (APO-1) antigen ligand 1) (Fas antigen ligand); Tumor necrosis factor ligand; tumor necrosis factor ligand 1A; tumor necrosis factor ligand superfamily member 6; Tumor necrosis factor ligand superfamily member 6 (TNFL6 / TNFSF6); Tumor necrosis factor ligand superfamily member 6, membrane form; Tumor necrosis factor ligand superfamily member 6, soluble form
Gene Fasl
Product Type Antibody
Gene ID (Entrez) 14103
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone MFL3
7,134

Invitrogen™ FLI1 Monoclonal Antibody (7.3)
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human,Mouse
Host Species Mouse
Conjugate Unconjugated
Applications ChIP Assay,Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P26323, Q01543
Isotype IgG3
Concentration 1 mg/mL
Antigen FLI1
Gene Symbols Fli1
Regulatory Status RUO
Purification Method Protein A
Gene Alias Ewing sarcoma breakpoint region 2; EWSR2; Fli1; Fli-1; Fli-1 proto-oncogene, ETS transcription factor; Friend leukemia integration 1; Friend leukemia integration 1 transcription factor; Friend leukemia virus integration 1; Proto-oncogene Fli-1; Retroviral integration site protein Fli-1; Sic1; SIC-1; transcription factor ERGB
Gene Fli1
Product Type Antibody
Gene ID (Entrez) 14247, 2313
Formulation PBS with 1mg/mL BSA, 30% glycerol and 0.05% sodium azide
Immunogen Recombinant human DHFR-FLICTER (C-terminal region of FLI-1) protein.
Classification Monoclonal
Primary or Secondary Primary
Clone 7.3
7,135

CD8a Monoclonal Antibody (53-6.7), eFluor™ 660, eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Rat
Conjugate eFluor 660
Applications Flow Cytometry,Immunohistochemistry (Frozen)
Form Liquid
Isotype IgG2a κ
Gene Accession No. P01731, P10300
Concentration 0.2 mg/mL
Antigen CD8a
Gene Symbols Cd8a, Cd8b1
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias BB154331; CD8; CD8 alpha; CD8 alpha chain; CD8 alpha chain precursor; CD8 antigen; CD8 antigen 32 kDa chain; CD8 antigen 37 kDa chain; CD8 antigen alpha polypeptide; CD8 antigen alpha protein; CD8 antigen alpha protein precursor; CD8 antigen alpha-chain; CD8 antigen beta polypeptide; CD8 antigen beta polypeptide precursor; CD8 antigen beta-chain; CD8 antigen, alpha chain; CD8 antigen, alpha polypeptide; CD8 antigen, alpha polypeptide (p32); CD8 antigen, alpha-chain; CD8 antigen, beta chain; CD8 antigen, beta chain 1; CD8 antigen, beta polypeptide; CD8 antigen, beta polypeptide 1 (p37); CD8 antigen, beta-chain; CD8 beta; CD8 beta chain; CD8 beta-2; CD8a; CD8A antigen alpha; CD8a molecule; CD8A; T-cell surface glycoprotein; CD8alpha; CD8B; CD8b antigen; CD8b molecule; CD8b molecule pseudogene; Cd8b1; CD8beta; CD8BP; fCD8; LEU2; Leu-2; Leu2 T-lymphocyte antigen; leu-2a; Ly-2; LY3; Ly-3; Ly-35; Ly-B; Ly-C; Lymphocyte antigen 3; Lyt2; Lyt-2; Lyt-2.1 lymphocyte differentiation antigen (AA at 100); Lyt3; Lyt-3; MAL; membrane glycoprotein; membrane protein; OKT8 T-cell antigen; OX-8 membrane antigen; p32; P37; RHACD8-4; T cell co-receptor; T lymphocyte surface glycoprotein beta chain; T8 T-cell antigen; T-cell antigen Leu2; T-cell membrane glycoprotein Ly-3; T-cell surface glycoprotein; T-cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 beta chain; T-cell surface glycoprotein Lyt-2; T-cell surface glycoprotein Lyt-3; T-cell surface molecule; T-lymphocyte differentiation antigen T8/Leu-2; type I transmembrane glycoprotein
Gene Cd8a
Product Type Antibody
Gene ID (Entrez) 12525, 12526
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone 53-6.7
7,136

Invitrogen™ CD274 (PD-L1, B7-H1) Monoclonal Antibody (MIH5), Alexa Fluor™ 488, eBioscience™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Rat
Conjugate Alexa Fluor 488
Applications Flow Cytometry
Form Liquid
Gene Accession No. Q9EP73
Isotype IgG2a λ
Concentration 0.5 mg/mL
Antigen CD274 (PD-L1, B7-H1)
Gene Symbols Cd274
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias A530045L16Rik; B7 homolog 1; B7-H; B7h1; B7-H1; Cd274; CD274 antigen; CD274 molecule; PDCD1 ligand 1; Pdcd1l1; Pdcd1lg1; Pdl1; PD-L1; pdl-1; Programmed cell death 1 ligand 1; programmed death ligand 1; RGD1566211; sCD274; soluble CD274; soluble PD L1; sPD L1
Gene Cd274
Product Type Antibody
Gene ID (Entrez) 60533
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone MIH5
7,137

Invitrogen™ IL-6 Monoclonal Antibody (MQ2-13A5), Brilliant Violet™ 650, eBioscience™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Rat
Conjugate Brilliant Violet 650
Applications Flow Cytometry
Form Liquid
Gene Accession No. P05231
Isotype IgG1 κ
Concentration 5 μL/Test
Antigen IL-6
Gene Symbols Il6
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias B-cell differentiation factor; B-cell hybridoma growth factor; B-cell stimulatory factor 2; BSF2; BSF-2; CDF; CHIL-6; CTL differentiation factor; cytokine; HGF; H-IL-6; HSF; hybridoma growth factor; Ifnb2; IFN-beta-2; Il6; IL-6; ILg6; ILN; interferon beta-2; Interleukin; interleukin 6; Interleukin 6 (interferon, beta 2); interleukin 6 precursor; interleukin BSF-2; interleukin HP-1; Interleukin6; Interleukin-6; interleukin-6 precursor; interleukin-6 protein; M-IL-6; prointerleukin 6; R-IL-6
Gene Il6
Product Type Antibody
Gene ID (Entrez) 3569
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone MQ2-13A5
7,138

CD16 Monoclonal Antibody (eBioCB16 (CB16)), Biotin, eBioscience™, Invitrogen™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate Biotin
Applications Flow Cytometry
Form Liquid
Isotype IgG1 κ
Gene Accession No. O75015, P08637
Concentration 0.5 mg/mL
Antigen CD16
Gene Symbols FCGR3A, FCGR3B
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias 4833442P21Rik; CD16; CD16-2; CD16A; CD16a antigen; CD16b; CD32; CD32 receptor 2; CDw32; cytolytic trigger molecule G7; Fc fragment of IgG intermediate affinity IV receptor; Fc fragment of IgG low affinity IIIa receptor; Fc fragment of IgG receptor IIIa; Fc fragment of IgG receptor IIIb; Fc fragment of IgG, low affinity III, receptor for (CD16); Fc fragment of IgG, low affinity IIIa, receptor; Fc fragment of IgG, low affinity IIIa, receptor (CD16a); Fc fragment of IgG, low affinity IIIa, receptor for (CD16); Fc fragment of IgG, low affinity IIIa, receptor for (CD16); Fc fragment of IgG, low affinity III, receptor for (CD16); Fc fragment of IgG, low affinity IIIb, receptor (CD16b); Fc gamma receptor III; Fc gamma receptor IIIa; Fc gamma receptor III-A; Fc gamma receptor IIIb; Fc gamma RIIIa; Fc gammaRIV; Fc receptor, IgG, low affinity III; Fc receptor, IgG, low affinity IV; Fc receptor-like 3; Fcg receptor III; FCG2; FCG3; Fc-gamma receptor III-2 (CD 16); Fc-gamma receptor IIIb (CD 16); Fc-gamma receptor IIIb (CD16); Fc-gamma RII-b; Fc-gamma RII-c; fc-gamma RIII; Fc-gamma RIIIa; Fc-gamma RIII-alpha; fc-gamma RIIIb; fc-gamma RIII-beta; Fc-gamma-RIIb; Fc-gamma-RIIc; FcgammaRIII; FcgammaRIII a.1; FcgammaRIII a.2; FcgammaRIII a.3; FcgammaRIIIA; FcgammaRIV; FCGR2; FCGR2A; FCGR2B; FCGR2C; FCGR3; Fcgr3a; FCGR3B; Fcgr4; FCGRIII; FcgRIV; FcR-10; FcRII-b; FcRII-c; FcRIII; FCRIIIA; FCRIIIb; Fcrl3; IGFR3; IgG Fc gamma receptor III; igG Fc receptor III; IgG Fc receptor III-1; igG Fc receptor III-2; IMD20; immunoglobulin G Fc receptor III; LOC100911825; Low affinity immunoglobulin gamma Fc region receptor III; low affinity immunoglobulin gamma Fc region receptor III-A; Low affinity immunoglobulin gamma Fc region receptor III-B; low affinity immunoglobulin gamma Fc region receptor III-like; Low affinity immunoglobulin gamma Fc region receptor IV; neutrophil-specific antigen NA; RP11-5K23.1; transmembrane receptor FcgammaRIII-X
Product Type Antibody
Gene ID (Entrez) 2214, 2215
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone eBioCB16 (CB16)
7,139

Invitrogen™ CD71 (Transferrin Receptor) Monoclonal Antibody (OKT9 (OKT-9)), Brilliant Violet™ 421, eBioscience™

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate Brilliant Violet 421
Applications Flow Cytometry
Form Liquid
Gene Accession No. P02786
Isotype IgG1 κ
Concentration 5 μL/Test
Antigen CD71 (Transferrin Receptor)
Gene Symbols TFRC
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias 2610028K12Rik; AI195355; AI426448; AU015758; CD antigen CD71; CD71; chicken transferrin receptor; E430033M20Rik; I79_000642; IMD46; mammary tumor virus receptor 1; Mtvr1; Mtvr-1; p90; sTfR; T9; TfR; tfR1; TFR2; TFRC; TR; transferrin receptor; transferrin receptor (p90, CD71); transferrin receptor 2; transferrin receptor protein 1; Transferrin receptor protein 1, serum form; Trfr
Gene TFRC
Product Type Antibody
Gene ID (Entrez) 7037
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone OKT9 (OKT-9)
7,140

CD4 Monoclonal Antibody (RM4-5), Alexa Fluor™ 532, eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Rat
Conjugate Alexa Fluor 532
Applications Flow Cytometry
Form Liquid
Isotype IgG2a κ
Gene Accession No. P06332
Concentration 0.2 mg/mL
Antigen CD4
Gene Symbols CD4
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias Activation B7-1 antigen; B7; B7.1; B7-1; BB1; B-lymphocyte activation antigen B7; CD28LG; CD28LG1; CD4; CD4 antigen; CD4 antigen (p55); CD4 antigen p55; Cd4 molecule; CD4 precursor; CD4 receptor; CD4, allele 1; cd4a; CD4mut; CD80; CD80 antigen (CD28 antigen ligand 1, B7-1 antigen); CD80 molecule; cell surface glycoprotein CD4; costimulatory factor CD80; costimulatory molecule variant IgV-CD80; CTLA-4 counter-receptor B7.1; fCD4; L3T4; LAB7; Leu-3; Ly-4; lymphocyte antigen CD4; lymphocyte antigen CD4 precursor; membrane protein; p55; T-cell differentiation antigen L3T4; T-cell surface antigen T4/Leu-3; T-cell surface glycoprotein CD4; T-cell surface glycoprotein CD4 precursor (T-cell surface antigen T4/Leu-3) (T-cell differentiation antigen L3T4); T-lymphocyte activation antigen CD80; W3/25; W3/25 antigen
Gene CD4
Product Type Antibody
Gene ID (Entrez) 12504
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone RM4-5