All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (7)
- (2)
- (3,051)
- (925)
- (1,939)
- (4,412)
- (1)
- (1)
- (3)
- (1)
- (1,258)
- (1,754)
- (921,451)
- (21,592)
- (2)
- (774)
- (61)
- (1)
- (29)
- (1)
- (5,588)
- (3,360)
- (1,862)
- (218)
- (1)
- (8,787)
- (12,059)
- (2,271)
- (9)
- (52)
- (1)
- (3)
- (4)
- (13)
- (2)
- (69)
- (5)
- (11)
- (12,287)
- (15,878)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (13)
- (2,669)
- (535)
- (1)
- (1)
- (136)
- (422)
- (3)
- (1)
- (3)
- (16)
- (110)
- (1)
- (190,004)
- (288,112)
- (1)
- (19)
- (798)
- (1)
- (12,214)
- (2)
- (129)
- (1)
- (2)
- (5)
- (11)
- (4)
- (9)
- (1)
- (2)
- (12)
- (34)
- (3)
- (1)
- (4)
- (1)
- (108)
- (1)
- (20)
- (19)
- (46)
- (1)
- (5)
- (1)
- (1)
- (10,751)
- (652)
- (1)
- (2)
- (1)
- (4)
- (6)
- (6)
- (1)
- (8)
- (3)
- (16)
- (2)
- (2)
- (329)
- (359)
- (5)
- (13,005)
- (2)
- (4,300)
- (2,250)
- (1)
- (14)
- (33)
- (1)
- (7)
- (1)
- (6,040)
- (3,903)
- (1)
- (20)
- (1)
- (1)
- (2)
- (40)
- (1)
- (2)
- (1)
- (17,537)
- (16,767)
- (18)
- (1)
- (1)
- (1)
- (5,545)
- (3)
- (2)
- (43)
- (4)
- (13)
- (1)
- (164)
- (748)
- (17)
- (2)
- (6)
- (1)
- (1)
- (2)
- (2,085)
- (1)
- (9)
- (3)
- (1)
- (1)
- (2)
- (6)
- (2)
- (2)
- (104)
- (1)
- (1)
- (3,866)
- (2)
- (20)
- (3)
- (112)
- (1)
- (1)
- (5)
- (2)
- (3)
- (33)
- (1)
- (5)
- (187)
- (2)
- (4,823)
- (12)
- (1)
- (2)
- (5)
- (9)
- (4)
- (7)
- (23)
- (130)
- (8,934)
- (39,658)
- (448)
- (53)
- (1,929)
- (1)
- (36)
- (7)
- (1)
- (2,681)
- (1)
- (4,478)
- (42)
- (2)
- (2)
- (1)
- (1)
- (4)
- (50)
- (1)
- (1)
- (815)
- (1)
- (1)
- (2)
- (2)
- (32)
- (40)
- (4)
- (6)
- (3)
- (6)
- (1)
- (3)
- (1)
- (3)
- (3)
- (31,161)
- (9)
- (1)
- (29)
- (2,893)
- (74)
- (89)
- (275)
- (2)
- (55)
- (29,965)
- (29,827)
- (6)
- (32,470)
- (16)
- (29,774)
- (45)
- (866)
- (48)
- (595)
- (30,794)
- (1)
- (32,527)
- (1)
- (3)
- (1)
- (73)
- (3)
- (30,317)
- (29,972)
- (3)
- (24,399)
- (24,961)
- (24,935)
- (24,831)
- (24,992)
- (24,794)
- (23)
- (127)
- (5)
- (103)
- (106)
- (2)
- (1)
- (92)
- (6)
- (15)
- (5)
- (34,906)
- (11)
- (3)
- (221)
- (761)
- (1,054)
- (721)
- (777)
- (920)
- (889)
- (1,009)
- (850)
- (1,470)
- (910)
- (835)
- (1,058)
- (1,059)
- (1,056)
- (681)
- (1,087)
- (30,490)
- (90)
- (9)
- (42)
- (17)
- (1)
- (103)
- (1)
- (139)
- (3)
- (79)
- (28,930)
- (28,983)
- (29,280)
- (63)
- (28,999)
- (25,597)
- (1)
- (60)
- (28,922)
- (28,575)
- (28,539)
- (17)
- (9)
- (1)
- (1)
- (7)
- (5)
- (33,652)
- (5)
- (30)
- (1)
- (1)
- (338)
- (734)
- (30,825)
- (1)
- (30,923)
- (27,238)
- (17,685)
- (17,678)
- (27,221)
- (30,927)
- (38)
- (1)
- (47)
- (9)
- (13)
- (2)
- (99)
- (11)
- (22)
- (58)
- (26)
- (127)
- (158)
- (25)
- (84)
- (58)
- (24)
- (56)
- (75)
- (9)
- (65)
- (73)
- (95)
- (84)
- (78)
- (28)
- (64)
- (70)
- (44)
- (58)
- (50)
- (53)
- (98)
- (122)
- (41)
- (58)
- (65)
- (77)
- (75)
- (454)
- (32,847)
- (7)
- (4)
- (311)
- (417)
- (2,778)
- (3,757)
- (24)
- (3)
- (37)
- (214)
- (2,662)
- (155)
- (41)
- (27,786)
- (558)
- (535)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,229)
- (858)
- (142)
- (536)
- (429)
- (878)
- (402)
- (325)
- (815)
- (756)
- (721)
- (2)
- (630)
- (722)
- (290)
- (752)
- (822)
- (634)
- (807)
- (12)
- (29)
- (116)
- (5)
- (274)
- (250)
- (125)
- (126)
- (95)
- (46)
- (11)
- (6)
- (5)
- (9)
- (3)
- (8)
- (2)
- (64)
- (14)
- (542,619)
- (7)
- (266)
- (49)
- (2)
- (367)
- (68)
- (47)
- (25)
- (271)
- (3)
- (3)
- (4)
- (29,993)
- (30,024)
- (29,977)
- (564)
- (2,894)
- (51)
- (1)
- (15)
- (1,780)
- (726)
- (3)
- (2)
- (6)
- (4)
- (5)
- (111,671)
- (68)
- (124)
- (2,111)
- (31,234)
- (221)
- (8)
- (23)
- (597,686)
- (16)
- (1)
- (800,240)
- (84,198)
- (3)
- (45,150)
- (174)
- (1)
- (1)
- (571)
- (2)
- (36)
- (23)
- (187)
- (1,232)
- (3)
- (4)
- (468)
- (98)
- (1)
- (1,429)
- (3)
- (2)
- (7)
- (2)
- (127)
- (2)
- (9)
- (95)
- (164)
- (51)
- (745)
- (1)
- (5)
- (8,432)
- (7,041)
- (12)
- (2)
- (1)
- (27)
- (27)
- (6)
- (161)
- (292)
- (1)
- (74)
- (2)
- (10,238)
- (43)
- (425)
- (171)
- (2,278)
- (156)
- (6)
- (348)
- (2)
- (1)
- (120)
- (1)
- (9)
- (10)
- (27)
- (84)
- (2)
- (23)
- (1)
- (677)
- (56)
- (8)
- (21)
- (109,131)
- (2)
- (2)
- (57)
- (70)
- (275)
- (18)
- (1,253)
- (6,085)
- (2)
- (7)
- (2)
- (2,152)
- (6)
- (57)
- (432,706)
- (31)
- (20,758)
- (15,649)
- (1,535)
- (377)
- (219)
- (79)
- (10,492)
- (4)
- (170)
- (28)
- (2)
- (28)
- (25)
- (1,047)
- (7)
- (2)
- (9)
- (18)
- (2)
- (1)
- (2)
- (92)
- (10)
- (2)
- (349,510)
- (2,675)
- (43,522)
- (93)
- (2)
- (50)
- (41)
- (1)
- (1)
- (4)
- (167)
- (2)
- (32,418)
- (127)
- (2)
- (1)
- (2)
- (150)
- (893)
- (15,271)
- (3)
- (2)
- (168)
- (30)
- (2)
- (2)
- (10)
- (819)
- (3)
- (2)
- (2)
- (2)
- (2)
- (10)
- (87)
- (64)
- (3)
- (337)
- (1,422)
- (2,837)
- (4)
- (290,189)
- (153,811)
- (191)
- (53)
- (197,229)
- (502,586)
- (77)
- (1,445)
- (43,005)
- (14)
- (267)
- (12,831)
- (529,532)
- (202)
- (609)
- (2)
- (3)
- (551)
- (6)
- (4)
- (211,657)
- (2,647)
- (27)
- (10)
- (51)
- (526)
- (25)
- (270)
- (1,156)
- (1,424)
- (7)
- (8)
- (1,339)
- (4)
- (2)
- (3)
- (26)
- (6,535)
- (1)
- (6)
- (814)
- (32)
- (9)
- (2)
- (434)
- (4)
- (4)
- (2)
- (22)
- (48)
- (1,208)
- (2)
- (16)
- (1,835)
- (1)
- (4)
- (2)
- (261)
- (437)
- (1,280)
- (39)
- (6)
- (43,437)
- (22)
- (1)
- (917)
- (85)
- (835)
- (1,910)
- (5)
- (2)
- (3)
- (2)
- (2)
- (22,381)
- (10)
- (1)
- (4)
- (1,390)
- (9)
- (2)
- (4)
- (135)
- (2)
- (1)
- (2,798)
- (105)
- (3)
- (13)
- (33)
- (1,513)
- (5)
- (2)
- (9,778)
- (4,867)
- (3,679)
- (1)
- (41)
- (11)
- (4,367)
- (2)
- (460)
- (442)
- (4)
- (26)
- (14)
- (52)
- (14)
- (2,645)
- (258)
- (3)
- (1)
- (1)
- (29)
- (13)
- (39)
- (2)
- (1)
- (2)
- (3)
- (1)
- (2)
- (1)
- (1,080,906)
- (3)
- (9,440)
- (19)
- (1)
- (51)
- (10)
- (74)
- (3)
- (3)
- (90)
- (40)
- (106)
- (494)
- (5)
- (728)
- (150)
- (62)
- (882)
- (8)
- (35)
- (8)
- (22)
- (5)
- (4)
- (2)
- (867)
- (2)
- (2,269)
- (51)
- (2)
- (5,101)
- (436)
- (1)
- (4)
- (24)
- (3)
- (4)
- (4)
- (8)
- (1)
- (2)
- (19,897)
- (1,027)
- (2,074)
- (426)
- (62)
- (1,190)
- (4)
- (9)
- (53)
- (9)
- (4)
- (47)
- (8)
- (29,698)
- (821)
- (2)
- (2)
- (4)
- (8)
- (5)
- (1,307)
- (9,923)
- (376)
- (1,447)
- (20)
- (855)
- (4)
- (2)
- (30)
- (2)
- (1)
- (1,022)
- (3)
- (9)
- (1)
- (18)
- (3)
- (2)
- (1,266)
- (3,505)
- (371)
- (2)
- (42)
- (5)
- (3)
- (4)
- (3)
- (6)
- (1,889)
- (12)
- (39)
- (4)
- (2,383)
- (164)
- (135)
- (50)
- (1,477)
- (263)
- (2)
- (14)
- (18)
- (1)
- (21)
- (4,674)
- (173)
- (44)
- (1)
- (2)
- (2)
- (5,218)
- (68)
- (578)
- (300)
- (3)
- (108)
- (1)
- (1,572)
- (43)
- (4)
- (2)
- (9)
- (497)
- (21)
- (352)
- (3)
- (3)
- (6)
- (149)
- (145)
- (1)
- (1,779)
- (126)
- (168)
- (42)
- (3)
- (2)
- (176)
- (1)
- (2)
- (36)
- (3,494)
- (218)
- (407)
- (1)
- (274)
- (240)
- (236)
- (160)
- (9)
- (15)
- (11)
- (5)
- (5,223)
- (308)
- (6)
- (10)
- (1)
- (4)
- (52)
- (23)
- (73)
- (2)
- (28)
- (709)
- (1,433,702)
- (695)
- (9)
- (19)
- (1)
- (5)
- (78)
- (519)
- (89)
- (57)
- (15)
- (80)
- (42)
- (441)
- (524)
- (3)
- (15)
- (4)
- (17)
- (107)
- (9)
- (17)
- (2)
- (24)
- (1)
- (24)
- (2)
- (2)
- (16)
- (59)
- (2)
- (18)
- (2)
- (496)
- (8)
- (1)
- (890)
- (1,201)
- (2)
- (8)
- (4)
- (59)
- (139)
- (4)
- (268)
- (1)
- (13)
- (23,997)
- (90)
- (8)
- (2)
- (3)
- (1)
- (571,371)
- (4,877)
- (1,533)
- (1)
- (254)
- (2)
- (3)
- (30)
- (28)
- (8)
- (798)
- (7,444)
- (5)
- (4)
- (46)
- (1,310)
- (23)
- (279)
- (113)
- (1)
- (143)
- (182)
- (1)
- (3)
- (13)
- (20)
- (62)
- (5)
- (6)
- (9)
- (17)
- (207)
- (18)
- (18,491)
- (545)
- (215)
- (25)
- (1,234)
- (6)
- (1)
- (3)
- (1)
- (3)
- (124)
- (11)
- (5)
- (14,722)
- (155)
- (401)
- (10)
- (4)
- (6)
- (62)
- (10,253)
- (532)
- (4)
- (10)
- (2)
- (338,682)
- (5,177)
- (2)
- (6)
- (399)
- (2)
- (33)
- (2,777)
- (1,119)
- (3)
- (10)
- (30)
- (65)
- (153)
- (57)
- (2)
- (247)
- (31)
- (36)
- (3)
- (951)
- (2)
- (5,182)
- (2)
- (1)
- (15)
- (2)
- (22)
- (1)
- (1)
- (2)
- (13)
- (1)
- (2)
- (1)
- (13)
- (3,894)
- (471)
- (1)
- (2)
- (19)
- (5)
- (6)
- (3)
- (9)
- (54)
- (8)
- (3)
- (1)
- (4)
- (87)
- (10)
- (2)
- (24)
- (2)
- (2)
- (42)
- (3)
- (2)
- (2)
- (23)
- (82)
- (2,574)
- (1)
- (8)
- (23)
- (2)
- (3)
- (1,402)
- (6)
- (22)
- (13)
- (4)
- (4)
- (202)
- (5)
- (1,337)
- (38)
- (6)
- (3)
- (19,930)
- (2)
- (50)
- (2)
- (5)
- (3)
- (148)
- (339)
- (183)
- (2,287)
- (1,820)
- (30)
- (16)
- (2)
- (2)
- (4,513)
- (5)
- (9)
Filtered Search Results
CD80 (B7-1) Monoclonal Antibody (2D10.4), APC, eBioscience™, Invitrogen™
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | APC |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG1 κ |
| Gene Accession No. | P33681 |
| Antigen | CD80 (B7-1) |
| Gene Symbols | CD80 |
| Regulatory Status | RUO |
| Gene | CD80 |
| Product Type | Antibody |
| Gene ID (Entrez) | 941 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 2D10.4 |
CD30 Monoclonal Antibody (Ber-H2), APC, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | APC |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG1 κ |
| Gene Accession No. | P28908 |
| Concentration | 5 μL/Test |
| Antigen | CD30 |
| Gene Symbols | TNFRSF8 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | Ber-H2; Cd30; CD30 antigen; CD30 molecule; CD30L receptor; cytokine receptor CD30; D1S166E; Ki; Ki-1; Ki-1 antigen; Lymphocyte activation antigen CD30; sCD30; soluble CD30; TNF receptor superfamily member 8; TNFRSF8; Tumor necrosis factor receptor superfamily member 8; tumor necrosis factor receptor superfamily, member 8; Tumor necrosis factor superfamily member 8; tumor necrosis factor superfamily, member CD30 |
| Gene | TNFRSF8 |
| Product Type | Antibody |
| Gene ID (Entrez) | 943 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | Ber-H2 |
CD265 (RANK) Monoclonal Antibody (R12-31), PE, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | PE |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG2a κ |
| Gene Accession No. | O35305 |
| Concentration | 0.2 mg/mL |
| Antigen | CD265 (RANK) |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Product Type | Antibody |
| Gene ID (Entrez) | 21934 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | R12-31 |
CD41a Monoclonal Antibody (HIP8), FITC, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | FITC |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG1 κ |
| Gene Accession No. | P08514 |
| Concentration | 5 μL/Test |
| Antigen | CD41a |
| Gene Symbols | Itga2b |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | AI172977; alpha IIb; alphaIIb; alphaIIb protein; BDPLT16; BDPLT2; CD41; CD41B; form 1; form 2; GP IIb; GP2B; GPalpha IIb; GPIIb; GT; GTA; HPA3; integrin alpha 2b; integrin alpha 2b (Cd41b); integrin alpha-IIb; Integrin alpha-IIb heavy chain; Integrin alpha-IIb light chain; Integrin alpha-IIb light chain, form 1; Integrin alpha-IIb light chain, form 2; integrin subunit alpha 2b; integrin subunit alpha IIb; integrin, alpha 2B; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); ITGA2B; ITGAB; platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb; platelet glycoprotein IIb of IIb/II Ia complex; platelet glycoprotein IIb of IIb/IIIa complex; platelet membrane glycoprotein IIb; platelet-specific antigen BAK; PPP1R93; protein phosphatase 1, regulatory subunit 93 |
| Gene | Itga2b |
| Product Type | Antibody |
| Gene ID (Entrez) | 3674 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | HIP8 |
Invitrogen™ GSDMD Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ELISA,Western Blot |
| Form | Liquid |
| Gene Accession No. | P57764 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | GSDMD |
| Gene Symbols | GSDMD |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | 1810036L03Rik; AW558049; DF5L; Dfna5l; FKSG10; gasdermin D; gasdermin domain containing 1; gasdermin domain-containing protein 1; Gasdermin-D; Gasdermin-D, C-terminal; Gasdermin-D, N-terminal; GSDMD; GSDMDC1; GSDMD-CT; GSDMD-NT; M2-4 |
| Gene | GSDMD |
| Product Type | Antibody |
| Gene ID (Entrez) | 79792 |
| Formulation | PBS with 50% glycerol and 0.09% sodium azide; pH 7.3 |
| Immunogen | Recombinant protein (or fragment). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ Vinculin Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P18206, P85972, Q64727 |
| Isotype | IgG |
| Concentration | 0.33 mg/mL |
| Antigen | Vinculin |
| Gene Symbols | VCL |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | 9430097D22; AA571387; AI462105; AW545629; CMD1W; CMH15; epididymis luminal protein 114; HEL114; metavinculin; meta-vinculin; metavinculin {ECO:0000250; MV; MVCL; RP11-178G16.3; UniProtKB:P18206}; unnamed protein product; Vcl; vcl {ECO:0000250; VIN; vinc; vinc 1; VINC1; Vinculin; vinculin {ECO:0000250 |
| Gene | VCL |
| Product Type | Antibody |
| Gene ID (Entrez) | 22330, 305679, 7414 |
| Formulation | PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7 |
| Immunogen | Recombinant protein encompassing a sequence within the center region of human Vinculin. The exact sequence is proprietary. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ CD314 (NKG2D) Monoclonal Antibody (1D11), Biotin, eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Biotin |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P26718 |
| Isotype | IgG1 κ |
| Concentration | 0.5 mg/mL |
| Antigen | CD314 (NKG2D) |
| Gene Symbols | Klrk1 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | CD314; D12S2489E; D6H12S2489E; killer cell lectin like receptor K1; Killer cell lectin-like receptor subfamily K member 1; killer cell lectin-like receptor subfamily K, member 1; KLR; Klrk1; natural killer cell group 2D; natural killer cell receptor; NK cell receptor D; NK lectin-like receptor; Nkg2d; NKG2-D; NKG2-D type II integral membrane protein; NKG2-D-activating NK receptor; NKLLR; Nkrp2; NKR-P2; NKR-P2, ortholog of human NKG2D |
| Gene | Klrk1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 22914 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 1D11 |
CD8a Monoclonal Antibody (53-6.7), PE-eFluor™ 610, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | PE-eFluor 610 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG2a κ |
| Gene Accession No. | P01731, P10300 |
| Concentration | 0.2 mg/mL |
| Antigen | CD8a |
| Gene Symbols | Cd8a, Cd8b1 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | BB154331; CD8; CD8 alpha; CD8 alpha chain; CD8 alpha chain precursor; CD8 antigen; CD8 antigen 32 kDa chain; CD8 antigen 37 kDa chain; CD8 antigen alpha polypeptide; CD8 antigen alpha protein; CD8 antigen alpha protein precursor; CD8 antigen alpha-chain; CD8 antigen beta polypeptide; CD8 antigen beta polypeptide precursor; CD8 antigen beta-chain; CD8 antigen, alpha chain; CD8 antigen, alpha polypeptide; CD8 antigen, alpha polypeptide (p32); CD8 antigen, alpha-chain; CD8 antigen, beta chain; CD8 antigen, beta chain 1; CD8 antigen, beta polypeptide; CD8 antigen, beta polypeptide 1 (p37); CD8 antigen, beta-chain; CD8 beta; CD8 beta chain; CD8 beta-2; CD8a; CD8A antigen alpha; CD8a molecule; CD8A; T-cell surface glycoprotein; CD8alpha; CD8B; CD8b antigen; CD8b molecule; CD8b molecule pseudogene; Cd8b1; CD8beta; CD8BP; fCD8; LEU2; Leu-2; Leu2 T-lymphocyte antigen; leu-2a; Ly-2; LY3; Ly-3; Ly-35; Ly-B; Ly-C; Lymphocyte antigen 3; Lyt2; Lyt-2; Lyt-2.1 lymphocyte differentiation antigen (AA at 100); Lyt3; Lyt-3; MAL; membrane glycoprotein; membrane protein; OKT8 T-cell antigen; OX-8 membrane antigen; p32; P37; RHACD8-4; T cell co-receptor; T lymphocyte surface glycoprotein beta chain; T8 T-cell antigen; T-cell antigen Leu2; T-cell membrane glycoprotein Ly-3; T-cell surface glycoprotein; T-cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 beta chain; T-cell surface glycoprotein Lyt-2; T-cell surface glycoprotein Lyt-3; T-cell surface molecule; T-lymphocyte differentiation antigen T8/Leu-2; type I transmembrane glycoprotein |
| Gene | Cd8a |
| Product Type | Antibody |
| Gene ID (Entrez) | 12525, 12526 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 53-6.7 |
CD144 (VE-cadherin) Monoclonal Antibody (16B1), Alexa Fluor™ 700, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Target Species | Human |
|---|---|
| Host Species | Mouse |
| Conjugate | Alexa Fluor 700 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG1 |
| Gene Accession No. | P33151 |
| Concentration | 5 μL/Test |
| Antigen | CD144 (VE-cadherin) |
| Gene Symbols | CDH5 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene | CDH5 |
| Product Type | Antibody |
| Gene ID (Entrez) | 1003 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 16B1 |
Invitrogen™ MULT1 (NKG2D Ligand) Monoclonal Antibody (5D10), eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Armenian Hamster Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C |
|---|---|
| Target Species | Mouse,Rat |
| Host Species | Armenian Hamster |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Frozen) |
| Form | Liquid |
| Gene Accession No. | 0 |
| Isotype | IgG |
| Concentration | 0.5 mg/mL |
| Antigen | MULT1 (NKG2D Ligand) |
| Gene Symbols | ULBP1 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | A430108B07Rik; ALCAN-beta; MULT1; N2DL1; N2DL-1; NKG2D ligand; NKG2D ligand 1; NKG2D ligand1; NKG2DL1; RAET1I; retinoic acid early transcript 1I; UL16 binding protein 1; UL16-binding protein 1; UL16-binding protein-like transcript 1; ULBP; ULBP 1; ULBP1 |
| Gene | ULBP1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 77777 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 5D10 |
CD90.1 (Thy-1.1) Monoclonal Antibody (HIS51), Biotin, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse,Rat |
| Host Species | Mouse |
| Conjugate | Biotin |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG2a κ |
| Gene Accession No. | P01830, P01831 |
| Concentration | 0.5 mg/mL |
| Antigen | CD90.1 (Thy-1.1) |
| Gene Symbols | Thy1 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | CD7; CD90; FLJ33325; T25; Thy 1.2; Thy1; Thy-1; Thy-1 antigen; Thy-1 cell surface antigen; thy-1 glycoprotein; thy-1 membrane glycoprotein; Thy-1 protein; Thy1.1; Thy1.2; Thy-1.2; thymus cell antigen 1, theta; Thymus cell surface antigen |
| Gene | Thy1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 21838, 24832 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | HIS51 |
Invitrogen™ HuD Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot |
| Form | Lyophilized |
| Gene Accession No. | O09032, P26378, Q61701 |
| Isotype | IgG |
| Concentration | 500 μg/mL |
| Antigen | HuD |
| Gene Symbols | ELAVL4 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | Elav; ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D); ELAV like neuron-specific RNA binding protein 4; ELAVL4; ELAV-like protein 4; Hu antigen D; HU-antigen D; Hud; Paraneoplastic encephalomyelitis antigen HuD; PNEM; RGD1561943; r-HuD; RNA-binding protein HUD3 |
| Gene | ELAVL4 |
| Product Type | Antibody |
| Gene ID (Entrez) | 15572, 1996, 432358 |
| Formulation | PBS with 5mg BSA and 0.05mg sodium azide |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ELAVL4 (8-45aa MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
CD28 Recombinant Mouse Monoclonal Antibody (CD28.2), Alexa Fluor™ Plus 647, Invitrogen™
Mouse Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Alexa Fluor Plus 647 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG1 κ |
| Gene Accession No. | P10747 |
| Concentration | 1.0 mg/mL |
| Antigen | CD28 |
| Gene Symbols | Cd28 |
| Regulatory Status | RUO |
| Purification Method | Protein A/G |
| Gene Alias | antigen CD28; CD28; CD28 antigen; CD28 antigen (Tp44); CD28 isoform; CD28 isoform 2; Cd28 molecule; CD28 precursor protein; CD28 protein; CD28 protein precursor; CD28RNA; cell surface protein; CHT28; contains partial extracellular domain; costimulatory molecule B7 receptor CD28; EGK_04709; MGC138290; sCD28; soluble CD28; T44; T-cell costimulatory molecule CD28; T-cell costimulatory molecule Tp44; T-cell-specific surface glycoprotein CD28; T-cell-specific surface glycoprotein CD28 homolog; TP44 |
| Gene | Cd28 |
| Gene ID (Entrez) | 940 |
| Formulation | Proprietary buffer with 0.008% Bromonitrodioxane, 0.008% Methylisothiazolone; pH 6.5 |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | CD28.2 |
Invitrogen™ CD328 (Siglec7) Monoclonal Antibody (S7.7), FITC
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. Store in the dark. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | FITC |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | Q9Y286 |
| Isotype | IgG1 |
| Concentration | 0.1 mg/mL |
| Antigen | CD328 (Siglec7) |
| Gene Symbols | SIGLEC7 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | Adhesion inhibitory receptor molecule 1; adhesion inhibitory receptor molecule 1, siglec-7; AIRM1; AIRM-1; CD328; CDw328; D-siglec; p75; p75/ AIRM-1; p75/AIRM1; QA79; QA79 membrane protein; sialic acid binding Ig like lectin 7; sialic acid binding Ig-like lectin 7; sialic acid binding immunoglobulin-like lectin 7; sialic acid-binding Ig-like lectin 7; Siglec; SIGLEC19P; SIGLEC7; SIGLEC-7; SIGLECP2 |
| Gene | SIGLEC7 |
| Product Type | Antibody |
| Gene ID (Entrez) | 27036 |
| Formulation | PBS with 1% BSA and 0.09% sodium azide |
| Immunogen | Siglec-7 3T3 transfected cells. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | S7.7 |
CD54 (ICAM-1) Monoclonal Antibody (HA58), APC, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | APC |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG1 κ |
| Gene Accession No. | P05362 |
| Concentration | 5 μL/Test |
| Antigen | CD54 (ICAM-1) |
| Gene Symbols | ICAM1 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | BB2; CD54; cell surface glycoprotein P3.58; Human rhinovirus receptor; ICAM; Icam1; ICAM-1; ICAM-1; CD54 homolog; Intercellular adhesion molecule 1; intercellular adhesion molecule 1 (CD54), human rhinovirus receptor; intercellular adhesion molecule-1; intercellular adhesion molecule-1 precursor; Ly 47; Ly-47; major group rhinovirus receptor; MALA2; MALA-2; MyD10; P3.58; sCD54; soluble CD54; Surface antigen of activated B cells |
| Gene | ICAM1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 3383 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | HA58 |