Chicken Secondary Antibodies
Aat Bioquest Biotin-4-fluorescein CAS 1032732-74-3 (5 mg)
This bifunctional biotin-fluorescein conjugate demonstrates better binding and stronger fluorescence than biotin fluorescein. This catalog is for 5 mg.
Aat Bioquest Glucose-UDP-Fluorescein Conjugate
Uridine-5'-diphospho-1-alpha-D-glucose (UDP-Glc) is a key intermediate in carbohydrate metabolism.
Kingfisher Biotech Inc Chicken IL-22 Recombinant Protein
The Chicken IL-22 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-22 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IL-22 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-22 Specifications: (Molecular Weight: 19.4 kDa) (Amino Acid Sequence: SPLPPKGTGV VSNAHQACRL RKINFQQPYI RNRTYTLAEM ARLSDQDTDN RLIGQQIYVN IRENNRCYMM KRITEIIVKD VLLTEAKERY PYAEDVAQFL ASLTSELSRC KYSGNREHIE KNLEEMKSKM KELGENGKNK AIGELDLLFD YIENACTDAP KKGGNKKKN (169)) (Gene ID: 417838). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IL-6 Recombinant Protein
The Chicken IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-6 Specifications: (Molecular Weight: 22.0 kDa) (Amino Acid Sequence: VPLPAAADSS GEVGLEEEAG ARRALLDCEP LARVLRDRAV QLQDEMCKKF TVCENSMEML VRNNLNLPKV TEEDGCLLAG FDEEKCLTKL SSGLFAFQTY LEFIQETFDS EKQNVESLCY STKHLAATIR QMVINPDEVV IPDSAAQKSL LANLKSDKDW IEKITMHLIL RDFTSFMEKT VRAVRYLKKT RSFSA (195)) (Gene ID: 395337). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IFN gamma Recombinant Protein
The Chicken IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IFN gamma Specifications: (Molecular Weight: 16.7 kDa) (Amino Acid Sequence: HTASSLNLVQ LQDDIDKLKA DFNSSHSDVA DGGPIIVEKL KNWTERNEKR IILSQIVSMY LEMLENTDKS KPHTKHISEE LYTLKNNLPD GVKKVKDIMD LAKLPMNDLR IQRKAANELF SILQKLVDPP SFKRKRSQSQ RRCNC (145)) (Gene ID: 396054). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IL-16 Recombinant Protein
The Chicken IL-16 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-16 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IL-16 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-16 Specifications: (Molecular Weight: 12.6 kDa) (Amino Acid Sequence: SSTSSVASDA SQESTTEETI CTITLDKTAA GLGFSLEGGK GSIHGDKPII INRIFKGTSL EQSSPVQPGD ELLQVHTTAL QGLTRFEAWN IIKALPDGPI TAIIKRKNPS SVTKKASETL) (Gene ID: 374270). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken TNFSF15 Recombinant Protein
The Chicken TNFSF15 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken TNFSF15 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken TNFSF15 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 Specifications: (Molecular Weight: 19.1 kDa) (Amino Acid Sequence: ERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKRGLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPTQLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL) (Gene ID: 417247). For research use only. Made in the USA
Abcam Chicken Anti-Goat IgG H&L (FITC) preadsorbed.
Chicken Anti-Goat IgG H&L (FITC) preadsorbed.
The product is subject to the following: Abcam Restricted Use Statement
Immunoreagents Inc CHICKEN A-RAT IGG AP
Secondary Antibody; Chicken anti-rat IgG (H&L) - Affinity Pure, Host: Chicken, Format: Liq, Label: None, Applications: WB, ELISA, IHC/ICC, IF, IP, FC
Immunoreagents Inc CHICKEN A-RAT IGG DYLIGHT 550
Secondary Antibody; Chicken anti-rat IgG (H&L) - Affinity Pure, min x w/Hu or Rb IgG or Serum Proteins, DyLight 550 Conjugate, Host: Chicken, Format: Lyo, Label: DyL550, Applications: WB, ELISA, IHC/ICC, IF, IP, FC, FACS
Immunoreagents Inc CHICKEN A-GOAT IGG BIO 0.5MG
Secondary Antibody; Chicken anti-goat IgG (H&L), Affinity Pure, min x w/Hu,Mu or RB IgG/SP, Biotin Conjugate, Host: Chicken, Format: Liq, Label: Biotin, Applications: WB, ELISA, IHC/ICC