Chicken Secondary Antibodies
Biotium Fluorescein Biotin
Fluorescein biotin (5-((N-(5-(N-(6-(Biotinoyl)amino)hexanoyl)amino)pentyl)thioureidyl) fluorescein) can be used to detect and quantify biotin binding sites and the degree of biotinylation of proteins. Also see biotin-rhodamine 110, biotin-4-fluorescein, and CF Dye Biotin conjugates. Properties: Ex/ Em= 494/518 nm; Yellow solid soluble in DMSO, or DMF; Store at -20°C and protect from light; C42H50N6O8S2; MW: 831; [134759-22-1]
Kingfisher Biotech Inc Chicken IL-21 Recombinant Protein
The Chicken IL-21 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-21 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IL-21 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-21 Specifications: (Molecular Weight: 14.2 kDa) (Amino Acid Sequence: ATSPKAMKYK QLSKTIDHLK DVVKDKDVEL LHTPENPGDG CLLTAVTCFQ NGILKLQPKN SQVNATFAKT VKILRRPFLP VSEGHCESSC ESYERKKPQE FLNSFSKLMQ KLFKNSTAER YGKSTI (126)) (Gene ID: 554218). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IFN alpha Recombinant Protein
The Chicken IFN alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IFN alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IFN alpha yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IFN alpha Specifications: (Molecular Weight: 19.0 kDa) (Amino Acid Sequence: CNHLRPQDAT FSHDSLQLLR DMAPTLPQLC PQHNASCSFN DTILDTSNTR QADKTTHDIL QHLFKILSSP STPAHWNDSQ RQSLLNRIHR YTQHLEQCLD SSDTRSRTRW PRNLHLTIKK HFSCLHTFLQ DNDYSACAWE HVRLQARAWF LHIHNLTGNT RT (162)) (Gene ID: 396398). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken CCL4 Recombinant Protein
The Chicken CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APVGSDPPTSCCFTYISRQLPFSFVADYYETNSQCPHAGVVFITRKGREVCANPENDWVQDYMNKMELN) (Gene ID: 395551). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IFN gamma Recombinant Protein
The Chicken IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IFN gamma Specifications: (Molecular Weight: 16.7 kDa) (Amino Acid Sequence: HTASSLNLVQ LQDDIDKLKA DFNSSHSDVA DGGPIIVEKL KNWTERNEKR IILSQIVSMY LEMLENTDKS KPHTKHISEE LYTLKNNLPD GVKKVKDIMD LAKLPMNDLR IQRKAANELF SILQKLVDPP SFKRKRSQSQ RRCNC (145)) (Gene ID: 396054). For research use only. Made in the USA
Innovative Research Inc CHICKEN HUM MOU RAT WNT-3A 2UG
Chicken, Human, Mouse, Rat WNT-3A Recombinant Protein Lyophilized 2ug
Cayman Chemical AB-CHMINACA metabolIte M2 1mg
Immunogen Fusion protein amino acids 2-77 of human KCNQ Host Mouse Species Reactivity ( ) Human mouse rat Applications ICC/IF IHC IP WB
Cayman Chemical AB-CHMINACA metabolIte M1B 1mg
A very long chain fatty acid (241n-9) enriched in nervous tissue and particularly abundant in sphingolipids such as sphingomyelin poorly produced in demyelinating disorders including multiple sclerosis and adrenoleukodystrophy binds and inhibits DNA polymerase B (Ki 4.0 uM) and HIV-1 reverse transcriptase (Ki 1.2 UM)