Pig Secondary Antibodies
Kingfisher Biotech Inc Swine IL-13 Recombinant Protein
The Swine IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-13 Specifications: (Molecular Weight: 13.2 kDa) (Amino Acid Sequence: LTCFGGLASP GPVPPHSTAL KELIEELVNI TQNQKTPLCN GSMVWSVNLT TSMYCAALES LINISDCSAI QKTQRMLSAL CSHKPPSEQV PGKHIRDTKI EVAQFVKDLL KHLRMIFRHG (120)) (Gene ID: 396721). For research use only. Made in the USA
Kingfisher Biotech Inc Swine IL-8 Recombinant Protein
The Swine IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-8 Specifications: (Molecular Weight: 9.1 kDa) (Amino Acid Sequence: ARVSAELRCQ CINTHSTPFH PKFIKELRVI ESGPHCENSE IIVKLVNGKE VCLDPKEKWV QKVVQIFLKR TEKQQQQQ (78)) (Gene ID: 396880). For research use only. Made in the USA
Kingfisher Biotech Inc Swine IL-17A Recombinant Protein
The Swine IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-17A Specifications: (Molecular Weight: 14.9 kDa) (Amino Acid Sequence: GIMIPQSPGCPKTEDKNFPQHVRVNLNILNRSTPARRPSDYSKRSTSPWTLQRNEDPERYPSVIWEAKCSHSGCINAEGKEDHHMNSVPIQQEILVLRREPRHCPNSFRLEKVMVTVGCTCVTPIVRHIS (130)) (Gene ID: 449530). For research use only. Made in the USA
Kingfisher Biotech Inc Swine LIF Recombinant Protein
The Swine LIF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine LIF applications are for cell culture, ELISA standard, and Western Blot Control. Swine LIF yeast-derived recombinant protein can be purchased in multiple sizes. Swine LIF Specifications: (Molecular Weight: 19.7 kDa) (Amino Acid Sequence: SPLSITPVNA TCATRHPCHS NLMNQIKNQL AQLNSSANAL FILYYTAQGE PFPNNLDKLC GPNVTNFPPF HANGTEKARL VELYRIIAYL GASLGNITRD QRSLNPGAVN LHSKLNATAD SMRGLLSNVL CRLCNKYHVA HVDVAYGPDT SGKDVFQKKK LGCQLLGKYK QVISVLARAF (180)) (Gene ID: 399503). For research use only. Made in the USA
Kingfisher Biotech Inc Swine TWEAK (TNFSF12)
The Swine TWEAK yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine TWEAK applications are for cell culture, ELISA standard, and Western Blot Control. The Swine TWEAK yeast-derived recombinant protein can be purchased in multiple sizes. Swine TWEAK Specifications: (Molecular Weight: 17.3 kDa) (Amino Acid Sequence: SAPKGRKPRA RRVIAAHYEV HPRPGQDGAQ AGVDGTVSGW EEAKINSSNP LRYDRQSGQF LVTRAGLYYL YCQVHFDEGK AVYLKLDLLV DDTLALRCLE EFSATAASSL GPQLRLCQVS GLLPLRPGSS LRIRTLPWAH LKAAPFLTYF GLFQVH (156)) (Gene ID: 100127163). For research use only. Made in the USA
Kingfisher Biotech Inc Swine CCL3L1 Recombinant Protein
The Swine CCL3L1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL3L1 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL3L1 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL3L1 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APLGADTPTACCFSYTSRQLPRKFVADYFETSSQCSKPGVIFQTKKGREVCANPEDAWVQEYISDLELNA) (Gene ID: 494459). For research use only. Made in the USA
Kingfisher Biotech Inc Swine IL-4 Recombinant Protein
The Swine IL-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-4 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-4 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-4 Specifications: (Molecular Weight: 12.5 kDa) (Amino Acid Sequence: HKCDITLQEI IKTLNILTAR KNSCMELPVT DVFAAPENTT EKETFCRAST VLRHIYRHHT CMKSLLSGLD RNLSSMANMT CSVHEAKKST LKDFLERLKT IMKEKYSKC (109)) (Gene ID: 397225). For research use only. Made in the USA
Kingfisher Biotech Inc Swine CCL17 Protein
The Swine CCL17 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL17 applications are for cell culture, ELISA Standard, ELISpot Control, and Western Blot Control. Swine CCL17 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL17 Specifications: (Molecular Weight:9.0 kDa) (Amino Acid Sequence:ARGTNVGREC CLEYFKGAIP LRKLVGWYQT SDECTRDAIV LVTFQGRAIC SDPKDTWVKK AIRYLKKNMK PQDPVTQKS). For research use only. Made in the USA.
Kingfisher Biotech Inc Swine CCL17 Protein
The Swine CCL17 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL17 applications are for cell culture, ELISA Standard, ELISpot Control, and Western Blot Control. Swine CCL17 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL17 Specifications: (Molecular Weight:9.0 kDa) (Amino Acid Sequence:ARGTNVGREC CLEYFKGAIP LRKLVGWYQT SDECTRDAIV LVTFQGRAIC SDPKDTWVKK AIRYLKKNMK PQDPVTQKS). For research use only. Made in the USA.
Innovative Research Inc US Pig Jaw Upper and Lower Fz
Innovative Grade US Origin Porcine Jaw Upper and Lower Frozen - Innovative Grade US Origin Porcine Jaw from Innovative Research is collected on a custom basis from US Origin abattoir animals located in the United States, ensuring that only the highest-quality material is provided. Processing Options Include Upper and Lower, Lower/Mandible, Lower With Gullet, TM, Upper/Maxilla, This product is available fresh or frozen.
Innovative Research Inc US Pig Lungs Trim Fz 2
Innovative Grade US Origin Porcine Lungs Trimmed Frozen Pair of 2 - Innovative Grade US Origin Porcine Lungs from Innovative Research is collected on a custom basis from US Origin abattoir animals located in the United States, ensuring that only the highest-quality material is provided. Processing Options IncludeTrimmed, Untrimmed, Untrimmed/Trachea, Untrimmed/Trachea/Esophagus, Trimmed/Trachea, Trimmed/Trachea/Esophagus. Most porcine lung products are available from adult, juvenile, or fetal animals. If you have an age preference, please note at time of ordering. If no preference is indicated, your order will be processed from our most readily-available age group. This product is available freshor frozen . We are able to accommodate most custom processing requests, so if you need something specific for your research, please be sure to let us know! If you're looking to order additional quantities, volume discounts may be available. Please inquire for a custom quote.
American Research Products Inc Anti SARS CoV 2 RBD Beta27 Fab
Anti-SARS-CoV-2 RBD (Beta-27 Fab) Research Grade