Protein Labeling Reagents
![eMolecules Broadpharm / FAM tetrazine 6-isomer / 1mg / 761705857 / BP-28958 / / / [null] / 559.538 / C31H21N5O6](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502460502.PNG-250.jpg)
eMolecules Broadpharm / FAM tetrazine 6-isomer / 1mg / 761705857 / BP-28958 / / / [null] / 559.538 / C31H21N5O6
Broadpharm / FAM tetrazine 6-isomer / 1mg / 761705857 / BP-28958 / / / [null] / 559.538 / C31H21N5O6
Medchemexpress LLC HY-15939 10mg Medchemexpress, 6-FAM SE CAS:92557-81-8 Purity:>98%
Medchemexpress, HY-15939 10mg 6-FAM SE CAS:92557-81-8 Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-OH (trifluoroacetate salt) 0.5MG
Synthetic peptide that forms fibrils with have the same antigenic and structural features as those of native AD amyloid filaments.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKMOLECULAR FORMULA: C170H230N43O50MOLECULAR WEIGHT:3676STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [109770-29-8], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: J. Kang et al., Nature, 325, 773 (1987)
![eMolecules Broadpharm / Sulfo-Cy3 hydrazide / 1mg / 761705751 / BP-28931 / / 2144762-62-7 / [null] / 630.780 / C30H38N4O7S2](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502458579.PNG-250.jpg)
eMolecules Broadpharm / Sulfo-Cy3 hydrazide / 1mg / 761705751 / BP-28931 / / 2144762-62-7 / [null] / 630.780 / C30H38N4O7S2
Broadpharm / Sulfo-Cy3 hydrazide / 1mg / 761705751 / BP-28931 / / 2144762-62-7 / [null] / 630.780 / C30H38N4O7S2
![eMolecules Broadpharm / MB 680R TFP Ester / 1mg / 713699961 / BP-28149 / / / [null] / 889.900 / C37H39F4N3O12S3](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502458595.PNG-250.jpg)
eMolecules Broadpharm / MB 680R TFP Ester / 1mg / 713699961 / BP-28149 / / / [null] / 889.900 / C37H39F4N3O12S3
Broadpharm / MB 680R TFP Ester / 1mg / 713699961 / BP-28149 / / / [null] / 889.900 / C37H39F4N3O12S3
Biotium Cyanine 647 Succinimidyl Ester
Biotium offers high quality amine-reactive succinimidyl ester (SE, or NHS-Ester) dyes used to label proteins, oligonucleotides, and nucleic acids. We offer Cyanine 555 (Cy3), Cyanine 647 (Cy5), Cyanine 770 (Cy5.5), and Cyanine 750 (Cy7) as high quality succinimidyl esters. Also see our CF Dye Succinimidyl Ester, available with more than 20 bright and photostable CF Dyes. Cyanine 647 is structurally identical to Cy5 from GE Healthcare. Properties: Ex / Em (water) = 650/665 nm; Dark blue solid soluble in DMF and DMSO; Store at -20°C and protect from moisture and light; C 43 H 58 N 4 O 10 S 2; MW: 855. Cy3, Cy5, Cy5.5, and Cy7 are registered trademarks of GE Healthcare.
![eMolecules Broadpharm / BDP 564/570 NHS ester / 1mg / 771351558 / BP-28883 / 95.000 / 150173-90-3 / [null] / 463.250 / C24H20BF2N3O4](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502457930.PNG-250.jpg)
eMolecules Broadpharm / BDP 564/570 NHS ester / 1mg / 771351558 / BP-28883 / 95.000 / 150173-90-3 / [null] / 463.250 / C24H20BF2N3O4
Broadpharm / BDP 564/570 NHS ester / 1mg / 771351558 / BP-28883 / 95.000 / 150173-90-3 / [null] / 463.250 / C24H20BF2N3O4
Cayman Chemical AM1248 azepn Isomer 1mg
An analog of the synthetic cannabinoid AM1248; intended for forensic and research purposes