
Cell Line Lysates
Biofluids containing aggregate cellular material produced by the disintegration or dissolution of a variety of cell lines; designed for use in immunoprecipitation and immunoassay procedures.
Host Species
- (1)
- (1)
- (100)
- (2)
- (43)
- (26)
Tissue
- (2)
- (1)
- (2)
- (1)
- (7)
- (3)
- (4)
- (8)
- (3)
- (1)
- (1)
- (1)
- (2)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (2)
- (5)
- (8)
- (1)
- (15)
- (11)
- (2)
- (4)
- (1)
- (2)
- (3)
- (2)
- (3)
- (2)
- (1)
- (1)
- (6)
- (2)
- (1)
- (1)
- (2)
- (3)
- (1)
Physical Form
- (17)
Conjugate
- (2)
- (14)
Form
- (16)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.

151
–
165
of
4,853
results
A-431 (human epidermoid carcinoma) Nuclear extract lysate, Non-denatured; Abnova
Non-denatured nuclear extract lysate of A-431 (human epidermoid carcinoma)
Invitrogen™ Human ADCK4 (aa 180-240) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | RQSADFMPRWQMLRVLEEELGRDWQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQY |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human ADCK4 (aa 180-240) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human MSL1 (aa 335-432) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | FGSTERKTPVKKLAPEFSKVKTKTPKHSPIKEEPCGSLSETVCKRELRSQETPEKPRSSVDTPPRLSTPQKGPSTHPKEKAFSSEIEDLPYLSTTEMY |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human MSL1 (aa 335-432) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human DNAJB4 (aa 274-337) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | GRNIPMSVNDIVKPGMRRRIIGYGLPFPKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHLPAS |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human DNAJB4 (aa 274-337) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human TACC2 (aa 886-979) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | NLPTHGGQEQALGSELQSQLPKGTLSDTPTSSPTDMVWESSLTEESELSAPTRQKLPALGEKRPEGACGDGQSSRVSPPAADVLKDFSLAGNFS |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human TACC2 (aa 886-979) Control Fragment |
Recombinant | Recombinant |
Compass Biomedical™ Gamma Irradiated PLUS™ Human Platelet Lysate
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Advanced human platelet lysate that is safe and consistent for the rapid expansion of human mesenchymal cell cultures.

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Compass Biomedical™ GMP PLUS™ Human Platelet Lysate
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Advanced human platelet lysate that is safe and consistent for the rapid expansion of human mesenchymal cell cultures.

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | Store at -80°C upon receipt. Thaw at room temperature or in a water bath. After thawing, aliquot and store at -20°C or colder. Long term storage at -80°C is recommended. Multiple freeze/thaw cycles are not recommended. |
---|---|
Format | Bottle |
Host Species | Human |
Product Type | Human Platelet Lysate |
Purity | GMP Grade |
Research Category | GMP |
For Use With (Application) | Cell Culture, Stem Cell Culture |
Compass Biomedical™ R&D PLUS™ Human Platelet Lysate
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Advanced human platelet lysate that is safe and consistent for the rapid expansion of human mesenchymal cell cultures.

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | Store at -80°C upon receipt. Thaw at room temperature or in a water bath. After thawing, aliquot and store at -20°C or colder. Long term storage at -80°C is recommended. Multiple freeze/thaw cycles are not recommended. |
---|---|
Format | Bottle |
Host Species | Human |
Product Type | Human Platelet Lysate |
Research Category | RD |
For Use With (Application) | Cell Culture, Stem Cell Culture |