
Cell Culture Media, Supplements, and Reagents
A variety of media, supplemental media components, and reagents suitable for cell culture operations and processes. Products include fully prepared media as well as antibiotics, growth factors, contamination detection and removal reagents, cell dissociation reagents, and more.
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.

1,636
–
1,650
of
13,833
results
Invitrogen™ Human PRSS23 (aa 27-113) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | PWKPTWPAYRLPVVLPQSTLNLAKPDFGAEAKLEVSSSCGPQCHKGTPLPTYEEAKQYLSYETLYANGSRTETQVGIYILSSSGDGA |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human PRSS23 (aa 27-113) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human APEH (aa 415-501) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | IDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQVP |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human APEH (aa 415-501) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human SARNP (aa 66-137) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | KPIELPVKEEEPPEKTVDVAAEKKVVKITSEIPQTERMQKRAERFNVPVSLESKKAARAARFGISSVPTKGL |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human SARNP (aa 66-137) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human ZNF260 (aa 1-55) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | MIGMLESLQHESDLLQHDQIHTGEKPYECNECRKTFSLKQNLVEHKKMHTGEKSH |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human ZNF260 (aa 1-55) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human CDV3 (aa 138-197) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | SGPWNKTAPVQAPPAPVIVTETPEPAMTSGVYRPPGARLTTTRKTPQGPPEIYSDTQFPS |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human CDV3 (aa 138-197) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human ZNF518B (aa 61-142) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | AKCKSVHKISLQDLQKGTGKDGMYVCFQCSLGAAPPNFHFVSNNSSATHVGNKTENFSSSVNSKFKVRNFKPGKYYCDKCRF |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human ZNF518B (aa 61-142) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human RPL28 (aa 70-131) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | QRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRSQKPVMVKRKRT |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human RPL28 (aa 70-131) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human YKT6 (aa 65-131) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | LCHVYVRNDSLAGVVIADNEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATIHYPALDGHLSRYQ |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human YKT6 (aa 65-131) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human NALCN (aa 1628-1721) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | QDNSMQPETSSQQQLLSPTLSDRGGSRQDAADAGKPQRKFGQWRLPSAPKPISHSVSSVNLRFGGRTTMKSVVCKMNPMTDAASCGSEVKKWWT |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human NALCN (aa 1628-1721) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human SHFM3 (aa 236-313) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | QCLHTIQTEDRVWSIAISPLLSSFVTGTACCGHFSPLRIWDLNSGQLMTHLGSDFPPGAGVLDVMYESPFTLLSCGYD |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human SHFM3 (aa 236-313) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human ADPRM (aa 175-246) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | QSSPKYEQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNEVLTFSDTNQEKVVIVSHLPIYP |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human ADPRM (aa 175-246) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human PRR15L (aa 4-94) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | EIGWWKLTFLRKKKSTPKVLYEIPDTYAQTEGDAEPPRPDAGGPNSDFNTRLEKIVDKSTKGKHVKVSNSGRFKEKKKVRATLAENPNLFD |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human PRR15L (aa 4-94) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human CNP (aa 171-243) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | ADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVTYFG |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human CNP (aa 171-243) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human KIAA1731NL (aa 2-86) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | CSGWSSSVIWRHTQFAVERCGFCGSSGPGAPLEPSTLGSKHLPWEAVSAGFADRNRNMDGAMWLSLCPDNEDLLWRKKHKLLQAR |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human KIAA1731NL (aa 2-86) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human RPH3AL (aa 20-91) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | QLALRAKLQTGWSVHTYQTEKQRRKQHLSPAEVEAILQVIQRAERLDVLEQQRIGRLVERLETMRRNVMGNG |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human RPH3AL (aa 20-91) Control Fragment |
Recombinant | Recombinant |