Cell Culture Media, Supplements, and Reagents
Medchemexpress LLC HY-100877 10mg Medchemexpress, GCN2-IN-1 CAS:1448693-69-3 Purity:>98%
Medchemexpress, HY-100877 10mg GCN2-IN-1 CAS:1448693-69-3 GCN2-IN-1 (A-92) is a potent general control nonderepressible 2 kinase ( GCN2 ) inhibitor with an IC 50 of <0.3 μM in the enzyme assay and an IC 50 of 0.3-3 μM in the cell assay [1] . Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Medchemexpress LLC Clindamycin phosphate | 24729-96-2 | MFCD11982855 | 98.0% | 1 G
Clindamycin phosphate is a broad-spectrum bacteriostatic lincosamide antibiotic. It acts as a proagent, converting in vivo to the active form, Clindamycin, through phosphatase ester hydrolysis. This compound is used in research for conditions such as acne and bacterial vaginosis, demonstrating no cytotoxicity. Its antimicrobial properties are enhanced when combined with platelet rich fibrin (PRF).
- Acts as a broad-spectrum bacteriostatic lincosamide antibiotic.
- Converts to active Clindamycin in vivo.
- Shows no cytotoxicity.
- Enhances antimicrobial properties when combined with platelet rich fibrin.
- Suitable for research and analytical applications.
Abcam Nourseothricin sulfate, 50MG
MW 600.6 Da, Purity >85%. Nourseothricin is group of a broad-spectrum antibiotic produced by Streptomyces variants; inhibits protein synthesis by inducing miscoding. Streptothricin antibiotic Nourseothricin (NTC) is used for a broad spectrum of viruses, bacteria and other unicellular or complex organisms.
The product is subject to the following: Abcam Restricted Use Statement
Research Products International Corp D-Pantothenic Acid Hemicalcium Salt, 25 Grams
D-Pantothenic Acid Hemicalcium Salt, 25 Grams
Medchemexpress LLC Oligomycin | 1404-19-9 | 10 MG
Oligomycin is an antifungal antibiotic that acts as an inhibitor of H+-ATP-synthase. It blocks oxidative phosphorylation and the electron transport chain. Additionally, Oligomycin inhibits HIF-1alpha expression in hypoxic tumor cells. For research use only, it is not sold to patients. The product appears as a solid, white to off-white in color.
- Antifungal antibiotic
- Inhibitor of H+-ATP-synthase
- Blocks oxidative phosphorylation
- Blocks the electron transport chain
- Inhibits HIF-1alpha expression in hypoxic tumor cells
- Suppresses TNF-induced apoptosis by inhibiting the F0 part of H+-ATP-synthase
- Sourced from microorganisms, specifically Streptomyces
- Solid, white to off-white appearance
eMolecules Medchem Express / Necrostatin 2 / 5mg / 446264392 / HY-14622 / / 852391-19-6 / MFCD19443135 / 277.710 / C13H12ClN3O2
Medchem Express / Necrostatin 2 / 5mg / 446264392 / HY-14622 / / 852391-19-6 / MFCD19443135 / 277.710 / C13H12ClN3O2
Medchemexpress LLC FB23 | 2243736-35-6 | 98.9% | 377.22 | 50 MG
FB23 is a potent and selective FTO demethylase inhibitor with an IC50 of 60 nM. It directly binds to FTO and selectively inhibits FTO's mRNA N6-methyladenosine (m6A) demethylase activity.
- Potent and selective FTO demethylase inhibitor
- IC50 of 60 nM against FTO
- Directly binds to FTO
- Selectively inhibits FTO's mRNA N6-methyladenosine (m6A) demethylase activity
- Inhibits proliferation of acute myeloid leukemia (AML) cells (e.g., NB4 and MONOMAC6)
- Suppresses MYC and E2F targets
- Activates apoptosis and p53 pathways
Medchemexpress LLC ZT-1a | 212135-62-1 | 99.8% | 445.73 | 100 MG
ZT-1a is a potent, non-ATP-competitive, and selective SPAK inhibitor. It inhibits SPAK activity and decreases SPS1-related proline/alanine-rich kinase (SPAK)-dependent phosphorylation of Na-K-2Cl cotransporter (NKCC1) and K-Cl cotransporters (KCCs).
- Potent, non-ATP-competitive, and selective SPAK inhibitor
- Inhibits SPAK activity with IC50s of 44.3, 35.0, and 46.7 μM
- Inhibits Na-K-2Cl cotransporter (NKCC1)
- Stimulates K-Cl cotransporters (KCCs)
- Decreases SPAK-dependent phosphorylation
- For research use only
Medchemexpress LLC Bio-THZ1 | 1604811-14-4 | 98.1% | 10 MG
bio-THZ1 is a biotinylated version of THZ1 that irreversibly binds to CDK7. THZ1 is identified as a selective and potent covalent CDK7 inhibitor with an IC50 of 3.2 nM.
- Biotinylated version of THZ1
- Irreversibly binds to CDK7
- Selective and potent covalent CDK7 inhibitor
- IC50 of 3.2 nM
CPC Scientific H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-OH (trifluoroacetate salt) 0.5MG
Peptide found to have anabolic effect on bone formation in rats that can inhibit the rapid decline in bone formation due to denervation.ONE-LETTER SEQUENCE: AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAMOLECULAR FORMULA: C180H287N57O48MOLECULAR WEIGHT:4016.57STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [112955-31-4], RESEARCH AREA: OsteoporosisREFERENCES: L.J. Suva et al., Science, 237, 893 (1987)
TARGETMOL CHEMICALS INC TEDIZOLID 10MG
Also available in 1 mg 2 mg 5 mg 25 mg 50 mg 100 mg 500 mg and bulk. Please contact Fisher for quotes. Tedizolid (DA-7157)is a novel oxazolidinone-class antibiotic that inhibits bacterial protein synthesis by binding to the 23S ribosomal RNA of the 50S subunit of the ribosome. purity: 99%
TOKU-E Trimethoprim ReadyMade™ Solution | 25 mg/ML in DMSO | filter-sterile | 1 ML
Trimethoprim ReadyMade™ Solution | 25 mg/ML in DMSO | filter-sterile | 1 ML
Crescent Chemical Co Inc SULFACHLOROPYRIDAZINE SOLN 1ML
Sulfachloropyridazine 100 µg/mL in Acetonitrile Pharma./veter. comp (WS Lsg) CAS 80-32-0 Molecular Weight - 284.7221 Storage - RT Catalog Num - DRE-XA16990100AL chemical
Medchemexpress LLC Cefazolin | 25953-19-9 | 99.7% | 100 MG
Cefazolin (Cephazolin) is a first-generation cephalosporin antibiotic that can be used in research for various bacterial infections. It also exhibits anti-inflammatory effects and can mitigate post-operative cognitive dysfunction (POCD).
- Antibiotic properties: First-generation cephalosporin antibiotic effective against various bacterial infections.
- Anti-inflammatory effect: Can attenuate post-operative cognitive dysfunction (POCD).
- High purity of 99.73%.
- Research use only.
- Versatile forms: Available as a solid and in solution.
Apexbio Technology LLC Lomeguatrib 192441-08-0 10mg
Lomeguatrib (CAS 192441-08-0) is a potent inhibitor of O6-alkylguanine-DNA methyltransferase (MGMT) an enzyme involved in DNA repair that mitigates the cytotoxic effects of alkylating agents In MCF-7 cells Lomeguatrib inactivates MGMT with an approximate IC50 of 6 nM By suppressing MGMT activity Lomeguatrib sensitizes MGMT-expressing cell lines such as A375P and select mutBRAF and mutNRAS melanoma models to temozolomide but does not alter sensitivity to dacarbazine Clinical investigations have demonstrated dose-dependent inactivation of MGMT in patient-derived tumor tissues and peripheral blood mononuclear cells highlighting Lomeguatrib s value as a research tool for studying MGMT-mediated resistance mechanisms in cancer