
Cell Culture Media, Supplements, and Reagents
Filtered Search Results

Gibco™ FreeStyle™ 293 Expression Medium
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More

Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
An animal origin-free, serum-free, protein-free formulation, allowing for easier purification


Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Shipping Condition | Room Temperature |
---|---|
Content And Storage | Storage conditions: 2°C to 8°C. Protect from light Shipping conditions: Ambient Shelf life: 12 months from date of manufacture |
Product Type | Expression Medium |
Form | Liquid |
Classification | Animal Origin-free,Chemically-defined,Protein-free,Serum-free |
Product Line | Freestyle™ |
Serum Level | Serum-free |
Cytiva SFM4Transfx-293 Media
Promote transfection using lipofection and support growth of HEK 293 cultures with HyClone™ SFM4Transfx-293 Media, a serum-free, animal-derived component free media.
Product Type | SFM4Transfx-293 |
---|---|
Form | Liquid |
Certifications/Compliance | cGMP |
Gibco™ CD 293 AGT™ Medium
CD 293 AGT™ is a protein-free, chemically-defined medium in an easy-to-use granular format.
Cell Line | 293 (HEK) |
---|---|
Included Antibiotics | No antibiotics |
Product Type | CD 293 Medium |
Form | Powder (AGT) |
Culture Type | Suspension Cell Culture |
Serum Level | Serum-free |
Gibco™ CD 293 Medium (1X)
CD 293 Medium is a chemically-defined, protein-free medium optimized for the growth of suspension cultures of 293 cells. CD 293 Medium contains no proteins or peptides of animal, plant, or synthetic origin.
Cytiva HyClone™ SFM4Transfx-293 Powdered Media
Promotes transfection using lipofection, polymer, or similar methods in HEK 293 cell culture.
Invitrogen™ Human DMRTB1 (aa 199-293) Control Fragment Recombinant Protein
Recombinant Protein

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | NPDRALGPEYPGGSSMHPYCPFPLGYLDAPPGVPLQQGFRHVSRSQYQGGGLVSEPGGDFQPSYYLPPPPPPLPPLPPLPPQPQFLPPGYLSALH |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human DMRTB1 (aa 199-293) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human NUS1 (aa 227-293) Control Fragment Recombinant Protein
Recombinant Protein

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | ASLLSSNGCPDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human NUS1 (aa 227-293) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human PCYT2 (aa 293-389) Control Fragment Recombinant Protein
Recombinant Protein

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | TAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIITNRLEYEARNQKKEAKELAFLEAARQQAAQPLGERDGDF |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human PCYT2 (aa 293-389) Control Fragment |
Recombinant | Recombinant |
Gibco™ FreeStyle™ F17 Expression Medium
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More

Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
An animal origin-free, chemically defined, protein-free medium specifically developed to support the growth and transfection of 293-F and CHO cells in suspension without adaptation.


Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Cell Line | HEK293 |
---|---|
Culture Environment | CO2 |
Purity or Quality Grade | Qualified for Further Manufacturing |
Form | Liquid |
Without Additives | No Glutamine |
Endotoxin Level | < 1 EU/mL |
Concentration | 1 X |
For Use With (Application) | Protein expression, viral vector production |
Sterility | Sterile |
Product Type | Expression Medium |
Classification | Animal Origin-free,Chemically-defined,Protein-free,Serum-free |
Culture Type | Suspension Cell Culture |
Product Line | Freestyle™ |
Serum Level | Serum-free |
Gibco™ Viral Production Medium, AGT™
Gibco Viral Production Medium, AGT, is the dry-format version of CTS Viral Production Medium, a chemically defined, serum-free, protein-free, animal origin-free, phenol red-free medium.
Cell Line | Viral Production Cells 2.0 |
---|---|
Form | Powder (AGT) |
Without Additives | No Phenol Red,No Antibiotics |
Concentration | 25.6 g/L |
Expression System | Mammalian |
For Use With (Application) | AAV Production |
Sterility | Non-sterile |
Cell Type | HEK 293 cells |
With Additives | Glucose,GlutaMAX |
Product Type | AAV Production Medium |
pH | 6.9 to 7.5 |
Culture Type | Suspension Cell Culture |
Shelf Life | 12 Months |
Product Line | AAV-MAX |
Gibco™ TrypLE™ Select Enzyme (1X), no phenol red
Gibco™ TrypLE™ Select is an animal origin free, recombinant enzyme for dissociating a wide range of adherent mammalian cells.

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More

Product Type | Cell Culture Dissociation Reagent |
---|---|
Form | Liquid |
Without Additives | No Phenol Red |
Shelf Life | 24 Months |
Concentration | 1 X |
Gibco™ Sf-900™ II SFM
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More

Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Optimized for the growth and maintenance of Spodoptera frugiperda (Sf9 and Sf21) cells

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Cell Line | Sf21, Sf9 |
---|---|
Content And Storage | Storage conditions: 2°C to 8°C. Protect from light Shipping conditions: Ambient Shelf life: 12 months from date of manufacture |
With Additives | Glutamine |
Product Type | Insect Cell Serum Free Medium (SFM) |
Form | Liquid |
Classification | Protein-free,Serum-free |
Species | S. frugiperda, Spodoptera frugiperda |
Product Line | Gibco™, Sf-900™ |
Serum Level | Serum-free |
Cell Type | Insect Cell |
Shipping Condition | Room Temperature |
---|---|
Cell Line | CHO, Insect Cells, 293 (HEK) |
Content And Storage | Store at 2 to 8°C |
Format | Bottle(s) |
Product Type | Anti-clumping Reagent |
Form | Liquid |
Classification | Animal Origin-free,Chemically-defined,Protein-free,Serum-free |
pH | 6 to 8 |
Culture Type | Suspension Cell Culture |
Source | Animal origin-free |
Product Line | Gibco™ |
Cell Type | Mammalian Cells |
Gibco™ Expi293™ Expression Medium
Expi293™ Expression Medium designed for growth, transfection of suspension-adapted human embryonic kidney (HEK) 293 cells.

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Product Type | Expression Medium |
---|---|
Form | Liquid |
Classification | Animal Origin-free,Chemically-defined,Protein-free,Serum-free |
Product Line | Expi293™ |
LIFE TECHNOLOGIES 293 SFM II
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More

Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
50-591-512 293 SFM II

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More