14-3-3 gamma Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP254679

Catalog No. NBP254679

Description

14-3-3 gamma Polyclonal specifically detects 14-3-3 gamma in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: 14-3-3 gamma
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: 14-3-3 gamma, 14-3-3 protein gamma, 14-3-3GAMMA, KCIP-1, Protein kinase C inhibitor protein 1, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gammapolypeptide
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: YWHAG
• Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids:EAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEIS
• Quantity: 100 μL
• Research Discipline: Cancer, Cell Cycle and Replication, Cellular Markers, Growth and Development, Neuronal Cell Markers, Neuroscience, Signal Transduction, Stem Cell Markers
• Gene ID (Entrez): 7532
• Target Species: Human, Mouse, Rat
• Isotype: IgG