Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
14-3-3 gamma Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | 14-3-3 gamma |
---|---|
Applications | Western Blot, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
14-3-3 gamma Polyclonal specifically detects 14-3-3 gamma in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
14-3-3 gamma | |
Polyclonal | |
Rabbit | |
Cancer, Cell Cycle and Replication, Cellular Markers, Growth and Development, Neuronal Cell Markers, Neuroscience, Signal Transduction, Stem Cell Markers | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
7532 | |
This antibody was developed against a Recombinant Protein corresponding to amino acids:EAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEIS | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human, Mouse, Rat | |
14-3-3 gamma, 14-3-3 protein gamma, 14-3-3GAMMA, KCIP-1, Protein kinase C inhibitor protein 1, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gammapolypeptide | |
YWHAG | |
IgG | |
Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title