15-PGDH/HPGD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP187061

Catalog No. NBP187061

Description

15-PGDH/HPGD Polyclonal specifically detects 15-PGDH/HPGD in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: 15-PGDH/HPGD
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
• Gene Alias: 15-hydroxyprostaglandin dehydrogenase [NAD+], 15-PGDH, EC 1.1.1, EC 1.1.1.141, hydroxyprostaglandin dehydrogenase 15-(NAD), NAD+-dependent 15-hydroxyprostaglandin dehydrogenase, PGDH1PGDH, Prostaglandin dehydrogenase 1, SDR36C1, short chain dehydrogenase/reductase family 36C, member 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human 15-PGDH/HPGD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: HPGD
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGI
• Quantity: 0.1 mL
• Research Discipline: Cancer, Immunology, Innate Immunity
• Gene ID (Entrez): 3248
• Target Species: Human
• Isotype: IgG

For Research Use Only