Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
15-PGDH/HPGD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$610.00
Specifications
Antigen | 15-PGDH/HPGD |
---|---|
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 |
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
15-PGDH/HPGD Polyclonal specifically detects 15-PGDH/HPGD in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
15-PGDH/HPGD | |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
15-hydroxyprostaglandin dehydrogenase [NAD+], 15-PGDH, EC 1.1.1, EC 1.1.1.141, hydroxyprostaglandin dehydrogenase 15-(NAD), NAD+-dependent 15-hydroxyprostaglandin dehydrogenase, PGDH1PGDH, Prostaglandin dehydrogenase 1, SDR36C1, short chain dehydrogenase/reductase family 36C, member 1 | |
HPGD | |
IgG | |
Affinity Purified | |
Specificity of human 15-PGDH/HPGD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 | |
Polyclonal | |
Rabbit | |
Cancer, Immunology, Innate Immunity | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
3248 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:LAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGI | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title