Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 17 beta-HSD14/HSD17B14 Antibody, Novus Biologicals™

17 beta-HSD14/HSD17B14 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15762520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15762520 20 μL
NBP157625 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15762520 Supplier Novus Biologicals Supplier No. NBP15762520UL

Description

Rabbit Polyclonal Antibody

17 beta-HSD14/HSD17B14 Polyclonal specifically detects 17 beta-HSD14/HSD17B14 in Human samples. It is validated for Western Blot.

Specifications

Antigen 17 beta-HSD14/HSD17B14
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9BPX1
Gene Alias dehydrogenase/reductase (SDR family) member 10, Dehydrogenase/reductase SDR family member 10, DHRS1017-beta-hydroxysteroid dehydrogenase 14, EC 1.1.1.-, hydroxysteroid (17-beta) dehydrogenase 14,17-beta-hydroxysteroid dehydrogenase DHRS10, retinal short-chain dehydrogenase/reductase 3, Retinal short-chain dehydrogenase/reductase retSDR3, retSDR3, RETSDR3,17-beta-HSD 14, SDR3, SDR47C1, short chain dehydrogenase/reductase family 47C, member 1
Gene Symbols HSD17B14
Host Species Rabbit
Immunogen Synthetic peptides corresponding to HSD17B14(hydroxysteroid (17-beta) dehydrogenase 14) The peptide sequence was selected from the middle region of HSD17B14. Peptide sequence QPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIP.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 51171
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.