26S proteasome subunit 9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP247561

Catalog No. NBP247561

Description

26S proteasome subunit 9 Polyclonal specifically detects 26S proteasome subunit 9 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: 26S proteasome subunit 9
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: 26S proteasome non-ATPase regulatory subunit 9, p27, proteasome (prosome, macropain) 26S subunit, non-ATPase, 9, Rpn4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PSMD9
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SDEEARQSGGSSQAGAVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVR
• Quantity: 0.1 mL
• Research Discipline: Breast Cancer, Cancer, Tumor Suppressors
• Gene ID (Entrez): 5715
• Target Species: Human
• Isotype: IgG

For Research Use Only