Learn More
Description
Specifications
Specifications
| Antigen | 4-1BB/TNFRSF9/CD137 |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | 4-1BB, 4-1BB ligand receptor, CD137 antigen, CD137MGC2172, CDw137, FLJ43501, ILAhomolog of mouse 4-1BB, induced by lymphocyte activation (ILA), interleukin-activated receptor, homolog of mouse Ly63, receptor protein 4-1BB, T cell antigen ILA, T-cell antigen 4-1BB homolog, T-cell antigen ILA, tumor necrosis factor receptor superfamily member 9, tumor necrosis factor receptor superfamily, member 9 |
| Gene Symbols | TNFRSF9 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQII |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
