5-HT2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25783225UL

Catalog No. NB393758

Description

5-HT2B Polyclonal specifically detects 5-HT2B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: 5-HT2B
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: 5-HT(2B), 5-HT-2B, 5-HT2B5-HT 2B receptor, 5-hydroxytryptamine (serotonin) receptor 2B, 5-hydroxytryptamine 2B receptor, 5-hydroxytryptamine receptor 2B, Serotonin receptor 2B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: HTR2B
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RYITCNYRATKSVKTLRKRSSKIYFRNPMAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQS
• Quantity: 25 μL
• Research Discipline: GPCR, Neuronal Cell Markers, Neuroscience, Neurotransmission
• Gene ID (Entrez): 3357
• Target Species: Human
• Isotype: IgG

For Research Use Only