Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

5-HT2B Antibody, Novus Biologicals™
SDP

Catalog No. NBP155429 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP155429 100 μL
NBP15542920 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP155429 Supplier Novus Biologicals Supplier No. NBP155429
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

5-HT2B Polyclonal specifically detects 5-HT2B in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen 5-HT2B
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunocytochemistry/Immunofluorescence 1:10-1:2000
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P41595
Gene Alias 5-HT(2B), 5-HT-2B, 5-HT2B5-HT 2B receptor, 5-hydroxytryptamine (serotonin) receptor 2B, 5-hydroxytryptamine 2B receptor, 5-hydroxytryptamine receptor 2B, Serotonin receptor 2B
Gene Symbols HTR2B
Host Species Rabbit
Immunogen Synthetic peptides corresponding to HTR2B(5-hydroxytryptamine (serotonin) receptor 2B) Antibody(against the N terminal of 5HT2B Receptor. Peptide sequence: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK.
Molecular Weight of Antigen 54 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline GPCR, Neuronal Cell Markers, Neuroscience, Neurotransmission
Primary or Secondary Primary
Gene ID (Entrez) 3357
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Pig, Bovine, Canine, Equine, Guinea Pig
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.