Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
5-HT2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15542920UL
Description
5-HT2B Polyclonal specifically detects 5-HT2B in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
5-HT2B | |
Polyclonal | |
Western Blot 1:100-1:2000, Immunocytochemistry/Immunofluorescence 1:10-1:2000 | |
P41595 | |
HTR2B | |
Synthetic peptides corresponding to HTR2B(5-hydroxytryptamine (serotonin) receptor 2B) Antibody(against the N terminal of 5HT2B Receptor. Peptide sequence QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK. | |
Affinity Purified | |
RUO | |
Primary | |
Human, Mouse | |
IgG |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
5-HT(2B), 5-HT-2B, 5-HT2B5-HT 2B receptor, 5-hydroxytryptamine (serotonin) receptor 2B, 5-hydroxytryptamine 2B receptor, 5-hydroxytryptamine receptor 2B, Serotonin receptor 2B | |
Rabbit | |
54 kDa | |
20 μL | |
GPCR, Neuronal Cell Markers, Neuroscience, Neurotransmission | |
3357 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction