5-HT3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP26888425UL

Catalog No. NB392848

Description

5-HT3A Polyclonal antibody specifically detects 5-HT3A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: 5-HT3A
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: 5-HT-3,5-HT3-A, 5-HT3R5-hydroxytryptamine receptor 3A, 5-hydroxytryptamine (serotonin) receptor 3A, 5-hydroxytryptamine receptor 3,5-HT3A5HT3R, HTR35HT3 serotonin receptor, Serotonin receptor 3A, Serotonin-gated ion channel receptor
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LRHLVLERIAWLLCLREQSTSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQELSSIRQFLEKRDEI
• Quantity: 25 μL
• Research Discipline: Neuronal Cell Markers, Neuroscience, Neurotransmission
• Gene ID (Entrez): 3359
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified