5-HT3E Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233578

Catalog No. NBP233578

Description

5-HT3E Polyclonal specifically detects 5-HT3E in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: 5-HT3E
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: A5X5Y0
• Gene Symbols: HTR3E
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LAFILSRATPRPALGPLSYREHRVALLHLTHSMSTTGRGVTFTINCSGF
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 285242
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 5-HT3 receptor subunit E splice variant HTR3Ea, 5-HT3c1,5-HT3E, 5-hydroxytryptamine (serotonin) receptor 3, family member E, 5-hydroxytryptamine receptor 3E, MGC120035, MGC120036, serotonin receptor 3E
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only